KEGG   Burkholderia gladioli BSR3: bgla_2g12950Help
Entry
bgla_2g12950      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bgla_2g12950
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     bgla_2g12950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 Fer4_7 PrmA
Motif
Other DBs
NCBI-ProteinID: AEA63742
UniProt: F2LJ52
LinkDB All DBs
Position
2:1613342..1614406
Genome map
AA seq 354 aa AA seqDB search
MRLRCMCLVIHAPNDLRYEEGEVEAPGAGQVRVQVAMGGICGSDLHYFRHGGFGAIRLQQ
PMVLGHEVAGTVVEVGEGVTAVSVGDRVAVNPSRPCGKCKYCLEGLPNQCLDMRFYGSAM
RMPHIQGAFRGALVCDAVQCVKVADHVPFSLAAMAEPFAVGLHAVSRAGPLIGRRVLVSG
CGPIGALAVAAAKAHGAREVVATDVVDEPLAVAKALGADKVVNVAADPEWIRAYAADKGS
FDVMLECSGNERALRDGLEVLRPRGVVVQLGLGGDVAIPQNVVVAKELTICGSFRFHSEF
ALAVQLINEGRVDLAPAITRVFPAREANEAFALAGDRRRAMKVLIDFEEAVAEA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcgttgcatgtgtctcgtcattcacgcaccgaacgatctgcgctacgaggag
ggcgaggtcgaggcgccgggcgcgggccaggtgcgcgtgcaggttgcgatgggcggcatc
tgcggctcggacctgcattatttccgtcatggcggcttcggcgcgatccggctgcagcag
ccgatggtgctcggccatgaagtggccggcacggtggtcgaggtgggcgagggcgtgacg
gcggtgagcgtcggcgatcgcgtcgccgtcaatccgagccggccttgcggcaagtgcaag
tactgcctcgaaggcctgccgaaccagtgtctcgacatgcgcttctacggcagcgcgatg
cgcatgccgcatatccagggtgcgttccgcggcgcactggtgtgcgacgccgtgcagtgc
gtgaaggtggccgaccatgtgccgttctcgctggccgcgatggccgagccgttcgcggtc
ggcctgcacgcggtgtcgcgcgcgggcccgctgatcgggcggcgcgtgctggtgtcgggc
tgcgggccgatcggcgcgctggccgtggccgccgccaaggcgcatggcgcgcgcgaggtg
gtggccaccgacgtggtggacgagccgctggcggtggcgaaggcgctgggcgccgacaag
gtcgtcaacgtcgccgccgatccggaatggatccgggcctacgcggccgacaagggcagc
ttcgacgtgatgctcgaatgctcgggcaacgagcgcgcgctgcgcgacgggctcgaggtg
ctgcgcccgcgcggcgtggtggtgcagctcggcctgggcggcgacgtggcgattccgcag
aacgtggtggtggccaaggagctgacgatctgcggctcgttccgtttccactcggaattc
gcgctggcggtgcagttgatcaacgaaggccgggtcgatctcgcgccggccatcacgcgc
gtgttcccggcgcgcgaggccaacgaggccttcgcgctggccggcgatcgtcggcgcgcg
atgaaggtgctgatcgacttcgaggaagccgtcgccgaagcctga

DBGET integrated database retrieval system