KEGG   Burkholderia gladioli BSR3: bgla_2g13040Help
Entry
bgla_2g13040      CDS       T01464                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bgla_2g13040
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     bgla_2g13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin NAD_binding_8 DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: AEA63751
UniProt: F2LJ61
LinkDB All DBs
Position
2:complement(1622847..1624433)
Genome map
AA seq 528 aa AA seqDB search
MLDANLKNQLKSYLEKLTRPIELVASLDDGAKSQELIALLKEIGELSPRVAVIERRDDAE
RKPSFSIGEPGKAAGIRFAGIPMGHEFTSLVLALLQVGGHPLKLDEDTIEQIRDLDGDFS
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKIDTGASERAAAAIANKEVFDVLVVGGGPAGAAAAIYSARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKFAAALEQHVKQYDVDVMDVQRAATLVPGKVNE
IHLENGAVLKAKTIVLSTGARWRELNVPGEREYRNKGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVREVTLIEFGQTLRADEVLQRKLRSLKNVTVITSAQTTELLGDGQKL
GSLVYLERETGETKRIELEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSIPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRQDVEVPVAAGEAVTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccagctgaagtcgtacctcgaaaagctcacccgcccg
atcgaactcgtcgcctcgctcgacgacggcgcgaagtcgcaggagctgatcgcgctgctg
aaggagatcggcgagctgtcgccgcgcgtggccgtgatcgaacgccgcgacgacgccgag
cgcaagccctcgttcagcatcggcgaaccgggcaaggctgccgggatccgctttgccggc
atcccgatgggccatgaattcacctcgctcgtgctggcgctgctgcaggtcggcggccac
ccgctcaagctcgacgaggacaccatcgaacagattcgcgatctcgacggcgatttttcc
ttcgagacgtatttctcgctgtcctgccagaactgcccggaagtggtccaggcgctgaac
gtgatggcgctgatcaacccgcgcatccgccacgtggcgatcgacggcgcgctgttccag
aacgaagtcgaggcacgccagatcatggcggtgccgaccatgttcctgaacggcgaaagc
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagatcgacacgggcgccagc
gagcgcgccgccgccgcgatcgccaacaaggaagtgttcgacgtgctggtggtgggtggt
ggcccggctggcgcggcggccgcgatctactcggcacgcaagggcattcgcaccggcgtg
gtggcggagcgcttcggcgggcaggtgctggacaccatggcgatcgagaacttcatctcc
gtgcaggaaaccgaaggaccgaagttcgccgccgcgctggagcagcacgtcaagcaatac
gacgtcgacgtgatggacgtgcagcgcgccgcgacgctggtcccgggcaaggtcaacgag
atccacctggaaaacggcgcggtgctgaaggccaagaccatcgtgctgtcgaccggcgcg
cgctggcgcgagctgaacgtgccgggtgaacgcgagtatcgcaacaagggcgtggcctac
tgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggccgtggtgggcggcggc
aactcgggtgtcgaggccgcgatcgacctggccggcatcgtgcgcgaggtcacgctgatc
gaattcggccagacgctgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctgaag
aacgtgacggtgatcaccagcgcgcaaaccaccgaactgctcggcgacgggcagaagctg
ggcagcctggtctacctcgaacgtgaaacgggcgaaaccaagcgcatcgaactcgaaggc
gtgttcgtgcagatcggtctggtgccgaacacggaatggctgaaaggcacgatcgagctg
tcgaagcacggcgagatcgtggtggatgcacgcggcgcgacctcgattcccggcgtgttc
gcggccggcgacgtgaccacggtgccctacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcttcgttgtcggccttcgactacctgatccgccaggacgtggaagtaccggtt
gccgctggcgaggccgtcaccgcctga

DBGET integrated database retrieval system