KEGG   Burkholderia gladioli BSR3: bgla_2g20220Help
Entry
bgla_2g20220      CDS       T01464                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00020  Citrate cycle (TCA cycle)
bgd00190  Oxidative phosphorylation
bgd00650  Butanoate metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Module
bgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bgd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_2g20220
   00650 Butanoate metabolism
    bgla_2g20220
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    bgla_2g20220
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     bgla_2g20220
    1.3.5.4  fumarate reductase (quinol)
     bgla_2g20220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AEA64457
UniProt: F2LML4
LinkDB All DBs
Position
2:complement(2577063..2577770)
Genome map
AA seq 235 aa AA seqDB search
MKQHRVVNVYRYDPDRDTRPRLQRFELELTAEDRMLLDVLGRLKAIDETLSYRRSCREGI
CGSDAMNINGRNGLACLTNMQALPAEITLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLI
NDTPPPERERRQSPEERDQLDGLYECILCACCSTQCPSYWWNPDKFVGPAGLLQAYRFIA
DSRDQATASRLDDLEDPYRLFRCRTIMNCSSVCPKGLDPALAIADIRAMLVRRTV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaccgcgtggtgaacgtgtaccgctacgatcccgaccgcgatacgcggccg
cgcctgcagcgcttcgaactcgaactgaccgccgaggatcgcatgctgctcgacgtgctg
ggcaggctcaaggcgatcgacgagacgctgtcctaccggcgctcctgccgcgagggcatc
tgcggctcggacgcgatgaacatcaacggccgcaacggcctggcctgcctgaccaacatg
caggcgctgccggccgagatcacgctgcgcccgctgccgggcctgccggtggtgcgcgac
ctgatcgtcgacatgacggatttcttcaaccagtaccattcgatccggccgtacctgatc
aacgacacgccgccgcccgagcgcgagcggcggcagtcgcccgaggaacgcgaccagctc
gacggcctctacgaatgcatcctgtgcgcctgctgctcgacgcagtgtccgtcgtactgg
tggaaccccgacaagttcgtgggaccggcgggcctgctgcaggcctaccgcttcatcgcc
gattcgcgcgaccaggccactgcctcgcgcctggacgatctggaggatccctatcgactg
tttcgctgccggaccatcatgaactgcagcagcgtgtgtccgaaggggctcgacccggcg
ctggcgatcgccgacatccgcgcgatgctggtgcgccgcacggtgtga

DBGET integrated database retrieval system