KEGG   Burkholderia gladioli BSR3: bgla_2g28820Help
Entry
bgla_2g28820      CDS       T01464                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    bgla_2g28820
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     bgla_2g28820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like Thi4 K_oxygenase DAO Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AEA65297
UniProt: F2LR51
LinkDB All DBs
Position
2:3558455..3560053
Genome map
AA seq 532 aa AA seqDB search
MLEANLKNQLKSYLDKLTRPIELVASLDDGAKSQELIALLKEIGELSPRVAVIERRDDAE
RKPSFSIGEPGKATGIRFAGIPMGHEFTSLVLALLQVGGHPLKLDEDTIEQIRNLEGDFS
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQDEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKIDTGASERAAAAIANKEVFDVLVVGGGPAGAAAAIYSARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKFAAALEQHVKQYDVDVMDVQRAATLVPGKVNE
IHLENGAVLKAKTIVLSTGARWRELNVPGEREYRNKGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVREVTLIEFGQTLRADEVLQRKLRSLPNVTVVTSAQTKELTGDGQKL
NGLIYLERETGETKRIDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSIPGVF
AAGDVTTVPYKQIVIAVGEGAKASLSAFDYLIRQDVEAPATAASPVREAVEA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagccaatctcaagaaccagttgaagtcgtacctcgacaagctcacccgcccg
atcgaactcgtcgcctcgctcgacgacggcgcgaagtcgcaggagctgatcgcgctgctg
aaggagatcggcgagctgtcgccgcgcgtggccgtgatcgaacgccgcgacgacgccgag
cgcaagccctcgttcagcatcggcgaaccgggcaaggctaccgggatccgctttgccggc
atcccgatgggccatgaattcacctcgctcgtgctggcgctgctgcaggtcggcggccac
ccgctcaagctcgacgaggacaccatcgaacagattcgcaatctcgaaggcgatttctcc
ttcgagacgtatttctcgctgtcctgccagaactgcccggaagtggtccaggcgctgaac
gtgatggcgctgatcaacccgcgcatccgccacgtggcgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccagatcatggcggtgccgaccatgttcctgaacggcgagagc
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagatcgacacgggcgccagc
gagcgcgccgccgccgcgatcgccaacaaggaagtgttcgacgtgctggtggtgggtggt
ggcccggctggcgcggcggccgcgatctactcggcacgcaagggcattcgcaccggcgtg
gtggcggagcgcttcggcgggcaggtgctggacaccatggcgatcgagaacttcatctcc
gtgcaggaaaccgaaggaccgaagttcgccgccgcgctggagcagcacgtcaagcaatac
gacgtcgacgtgatggacgtgcagcgcgccgcgacgctggtcccgggcaaggtcaacgag
atccacctggaaaacggcgcggtgctgaaggccaagaccatcgtgctgtcgaccggcgcg
cgctggcgcgagctgaacgtgccgggtgaacgcgagtatcgcaacaagggcgtggcctac
tgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggccgtggtgggcggcggc
aactcgggtgtcgaggccgcgatcgacctggccggcatcgtgcgcgaggtcacgctgatc
gaattcggccagacgctgcgcgccgacgaagtgctgcaacgcaagctgcgcagcctcccg
aacgtgacggtggtgaccagcgcgcaaaccaaggagctgacgggcgacggccagaagctg
aacggcctgatctacctcgaacgtgaaacgggcgaaaccaagcgtatcgacctcgaaggc
gtgttcgtgcagatcggtctggtgccgaacacggaatggctgaagggcacgatcgagctg
tcgaagcacggcgagatcgtggtggatgcacgcggcgcgacgtcgattcccggcgtgttc
gcggccggcgacgtgaccacggtgccctacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcttcgttgtcggccttcgactacctgatccgccaggacgtcgaggcgcccgcg
actgcagcgtcaccggtacgcgaagccgtcgaagcgtga

DBGET integrated database retrieval system