KEGG   Burkholderia sp. CCGE1002: BC1002_0828Help
Entry
BC1002_0828       CDS       T01217                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bge  Burkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1002_0828
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BC1002_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: ADG14924
UniProt: D5W582
LinkDB All DBs
Position
1:916974..917681
Genome map
AA seq 235 aa AA seqDB search
MTDLSAFAITNKWPAEHPDRIQLYSLPTPNGVKISIMLEETGLPYEPHLVRFDTNDQMTP
AFLSLNPNNKIPAILDPNGPDGKPLPLFESGAILIYLADKSGQLIPKDAAGRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGREYEDKRPRDRYIAESKRLLGVLEQRLEGRAWVMGDQYS
IADIAIFPWVRNLVGFYEAGELVGIQDFPNVRRVLAAFVERPAVARGLNIPQRPA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttatccgctttcgcgatcacgaacaaatggccggccgagcatccggaccgg
attcagctctattcgctgccgacgcccaatggcgtaaaaatctcgatcatgctcgaggaa
accggcttgccgtacgagccgcatctggtgcgtttcgataccaacgatcaaatgacgccg
gcgtttctgtcgctgaacccgaacaacaagattccggcgatcctcgatccgaacggtccc
gacggcaaaccgctgccgctgttcgaatcgggcgcgatcctgatttacctggccgacaaa
agcggccagctgatcccgaaagacgccgctgggcgctacgagacgatccagtgggtgatg
ttccagatgggcggcatcggtccgatgttcggccaggtcggcttcttccacaaattcgcc
ggcagggaatatgaggacaagcgtccgcgcgatcgctacatcgcagaatcgaagcggctg
ctcggcgtgctggagcagcgcctcgaaggacgcgcctgggtgatgggcgatcagtattcg
atcgccgatatcgcgatcttcccgtgggtgcgcaatctggtcggcttctacgaggcaggc
gagctggtcggcattcaggacttcccgaacgtgcggcgcgtgcttgctgcgttcgtcgag
cgtccggcggtggcgcgcggcctgaatattccgcagcggccggcctga

DBGET integrated database retrieval system