KEGG   Burkholderia sp. CCGE1002: BC1002_0985Help
Entry
BC1002_0985       CDS       T01217                                 

Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1002_0985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bge02000]
    BC1002_0985
Enzymes [BR:bge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BC1002_0985
Transporters [BR:bge02000]
 Other Transporters
  Pores ion channels [TC:1]
   BC1002_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: ADG15079
UniProt: D5W608
LinkDB All DBs
Position
1:1086625..1087272
Genome map
AA seq 215 aa AA seqDB search
MIKLCGFALSNYYNKVKFVLLEHGIDFEEHLVKPSQDEALLEHSPLGKVPYLQTEHGDLC
ESQCIVEYLAARFPDKRIFSADSWQAAKEREMIFFVDVHLELTVRNLYKEAFFGGTVSDA
TKGRVEKLLTHHIAGFKRIAKLAPYLCGENFSVADTAGYVNLPLVGMATQTIYGRDFLLE
AGIDWKSYVKTINARPAAQRVTEDRKAYVAASRAS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctgtgcggttttgccctttccaactactacaacaaggtcaagttcgtgctg
ctcgaacacggcatcgacttcgaggagcatctcgtgaagccgagtcaggacgaagcgctg
ctcgagcattcgccgctcggcaaggtgccatacctgcagaccgagcacggcgacctgtgc
gagtcgcagtgcatcgtcgaatatctggccgcgcgttttcccgacaagcggatcttctcc
gccgattcgtggcaggccgccaaggaacgcgaaatgatcttcttcgtcgatgtgcatctc
gagctgacggtgcgcaatctgtacaaggaagcgtttttcggcggcacggtcagcgacgcg
acgaaagggcgcgtcgaaaagctgctcacgcaccacatcgccggcttcaagcggatcgcg
aagttggcgccgtacctgtgcggcgagaacttcagcgtcgcggataccgccggctacgtg
aacctgccgctcgtcggtatggcgacgcagaccatttacggccgcgattttctgctcgaa
gcggggatcgactggaagagctacgtgaagacgatcaacgcgcggccggctgcgcagcgc
gtgaccgaggatcgcaaggcctatgtcgcggcgtcgcgtgcgtcctga

DBGET integrated database retrieval system