KEGG   Burkholderia sp. CCGE1002: BC1002_1198Help
Entry
BC1002_1198       CDS       T01217                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00020  Citrate cycle (TCA cycle)
bge00310  Lysine degradation
bge00380  Tryptophan metabolism
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
bge01200  Carbon metabolism
Module
bge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1002_1198
  09105 Amino acid metabolism
   00310 Lysine degradation
    BC1002_1198
   00380 Tryptophan metabolism
    BC1002_1198
Enzymes [BR:bge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BC1002_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADG15283
UniProt: D5W788
LinkDB All DBs
Position
1:1342734..1344002
Genome map
AA seq 422 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPAAGVLAQV
ISNDGDTVTADQVIAKIDTEGTAGAAAVEAEVKPAPVAAAAPAPAAQAATATGSNTAASP
AAGKLMAEKGLAAGDVAGTGRDGRITKGDVLTAGAPAAKAAPAPAAAPKAAKPSLPDVKA
PASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYKDK
FEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPI
LRNADQLSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQS
AILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLL
DL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctctccgagtcggtctcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaggctgtcgctcaggacgaaatcctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggctccggcagcaggcgtgctcgcgcaagtc
atctcgaacgacggcgacacggtcacggcggatcaggtgatcgcgaagatcgacaccgaa
ggcaccgcaggcgccgccgctgtcgaagcggaagtgaagccggctccggtcgccgcagcg
gctcccgcgccggcagctcaggctgctaccgcaacgggctcgaacaccgcagcttcgccg
gctgccggcaagctgatggccgagaagggtctggccgctggcgacgtcgctggcacgggc
cgcgacggccgcatcaccaagggcgacgtgctcaccgctggcgcaccggctgccaaggct
gcaccggctccggctgccgcaccgaaggctgcgaagccgtcgctgccggacgtcaaggct
ccggcatcggccgaccagtggctgaaggaccgtccggaacagcgcgtgccgatgtcgcgt
ctgcgtgcgcgtatcgccgagcgtctgctcgagtcccagcaaaccaacgccatcctcacg
acgttcaacgaagtgaacatggcgccggtcatggagctgcgcaacaagtacaaggacaag
ttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggctgtt
catgcgctgaagaagttcccgctcgtgaacgcatcgatcgacggtaacgacatcgtctat
cacggctacttcgacatcggtatcgcggtcggttcgccgcgcggtctggtggtgccgatc
ctgcgcaatgcagaccagctgagcctcgccgacatcgagaagaagatcgccgaattcggc
cagaaggcgaaggacggcaagctgtcgatcgaagaaatgaccggcggtacgttctcgatc
tcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcagtcc
gcgattctcggcgtgcacgccacgaaggaacgcgctgtcgtcgaaaacggccagatcgtg
atccgcccgatgaactacctcgcgctgtcgtacgaccatcgtatcatcgacggccgcgaa
gccgtgctgtcgctggtcgccatgaaggacgcgctggaagatccggcacgtctgctgctt
gacctgtaa

DBGET integrated database retrieval system