KEGG   Burkholderia sp. CCGE1002: BC1002_2492Help
Entry
BC1002_2492       CDS       T01217                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bge  Burkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1002_2492
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BC1002_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ADG16543
UniProt: D5WCE0
LinkDB All DBs
Position
1:complement(2777457..2778545)
Genome map
AA seq 362 aa AA seqDB search
MTTQSDQQNMTAIVCHAPKDYRVEQVQKPRARAHELVIRIAACGICASDCKCHSGAKMFW
GGPSPWVKAPVIPGHEFFGYVEELGEGAAEHFGVQKGERVIAEQIVPCGKCRYCKSGQYW
MCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVNRGD
LQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADVTINPQKDDA
LAIIRSLTDGYGCDVYIETTGAPIGVNQGMDLIRKLGRFVEFSVFGADTTLDWSVIGDRK
ELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIRIANSLDSIKVLMKP
RA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaatccgaccagcagaacatgaccgccatcgtctgtcacgcaccgaaagac
tatcgcgtcgagcaggtacagaagccacgcgcccgcgcgcatgaactggtgatccgcatc
gccgcgtgcggcatctgcgcgagcgactgcaaatgtcattcgggcgcgaagatgttctgg
ggcggcccgagcccgtgggtcaaggcgccggtgattccgggccacgagttcttcggctat
gtcgaggaactgggcgagggtgcggccgagcacttcggcgtgcaaaagggcgagcgcgtg
atcgccgagcagatcgtgccgtgcggcaagtgccgctactgcaaatccggccagtactgg
atgtgcgaagtgcacaacatcttcggctttcagcgtgaagtcgcggacggcggcatggcc
gagtacatgcgtattccgccgaccgcgatcgtccacaagattcccgatggcatctcgctc
gaagacgccgcgatcatcgagccgctcgcgtgcgcgattcacacggtcaatcgcggcgat
ctgcaacttgacgacgtcgtcgtgatcgcgggcgcggggccgctcggtctgatgatgacg
caggtcgcgcatctgaagacgccgaagaagctcgtcgtgatcgatctcgtcgaagaacgg
ctcgcactcgcgcgcgaatacggcgcggacgtgacgatcaatcctcagaaggacgatgcg
ctcgcgatcattcgttcactgaccgacggctacggctgtgacgtctatattgaaacgacg
ggcgcaccgatcggcgtgaatcaggggatggacctgatccgcaagctcgggcgcttcgtc
gaattctcggtattcggcgcggacacgacgctcgactggtcggtgatcggcgatcgcaag
gaactcgacgtgcgcggcgcgcatctcggtccctattgctatccgatcgcgatcgatcta
ctcgcgcgcggactcgtcacgtcgaagggcatcgtcacgcacggcttttcgttggaagaa
tgggacgaagcgatcaggatcgcgaactcgctcgactcgatcaaggtgctgatgaagccg
cgcgcatga

DBGET integrated database retrieval system