KEGG   Burkholderia sp. CCGE1002: BC1002_2589Help
Entry
BC1002_2589       CDS       T01217                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00564  Glycerophospholipid metabolism
bge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BC1002_2589
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BC1002_2589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C 3HCDH_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADG16638
UniProt: D5WD12
LinkDB All DBs
Position
1:2884917..2886446
Genome map
AA seq 509 aa AA seqDB search
MTQGTKYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLAAHTSSASTKLIHGGLRYLE
YREFGLVRKALQERETLLRAAPHIIWPLRFVMPHMPELRPVWLIRAGLFLYDHLAKRELL
PGSRGIAMSRHPAGAPLVETIKRGFVYSDGWVNDARLVVLNALDAHERGATILTRTKLIA
AVRASGEWRAQLQRADGTTLDVRAAAIANAAGPWVGELLKGPLGRPSSHSVRLVKGSHIV
TRRLFEHDHAYIFQNPDKRIIFAIPYEHDYTLIGTTDLEYRGDPSRVAIDANETQYLCDS
INRYFRQKISPADVRWSYSGVRPLLEDENADNPSAVTRDYSLELDAPANEAPLLSVFGGK
ITTFRKLAEQAVDTLTDALHHGAPAWTADAPLPGGDIAQANFNRFLGEFSREHAWLPASL
AHRLARAYGTRANRVIGPARSRAELGREFAPGLHEAELVYLRDTEWARTAQDVLWRRSKL
GLHVEPGTLEPVTRDIDAWFAHEPARQSA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggcacgaaatacgatctgctcgtcgtcggtggcgggatcaacggcgccggc
atcgcccgcgacgcggccggccgtggtctgtcggtgctgctgtgcgaacaggacgatctg
gccgcgcacacgtcgtcggcgagcaccaagctgatccacggcgggctgcgctacctcgag
taccgcgagttcgggctcgtgcgcaaggcgctgcaggagcgcgaaacgttgctgcgcgcg
gcgccgcacatcatctggccgctgcgcttcgtgatgccgcacatgcccgagctgcgcccc
gtgtggctgattcgcgcgggtcttttcctctacgaccatctggccaaacgcgaactgctg
ccgggctcgcgcggcatcgcgatgagccggcatccggccggcgcgccgctcgtcgaaacg
atcaagcgcggtttcgtttattcggacggctgggtcaacgacgcccgcctcgtcgtgctg
aacgcgctcgacgcgcacgagcgcggcgccacgatcctcacgcgcacgaagctgatcgcc
gctgtgcgcgccagcggcgagtggcgcgcgcaactgcaacgcgcggacggcaccacgctc
gacgtgcgcgccgccgcgatcgcgaacgcggcgggcccgtgggtcggcgagctgctgaag
gggccgctcggccggccgtcgtcgcatagcgtgcggctcgtcaagggcagccacatcgtc
acgcggcgcctgttcgaacacgaccacgcgtacatcttccagaacccggacaagcggatc
atcttcgcgattccctatgagcacgactacacgctgatcggcacgaccgacctcgaatat
cgcggcgacccgtcccgagtcgcgatcgacgccaacgaaacgcagtacctgtgcgattcg
atcaaccgctacttcaggcagaagatctcgcccgccgacgtgcgctggagctattcgggc
gtacgcccgctgctggaggacgagaacgcggacaatccgtcggcggtcacgcgcgactac
tcgctcgaactcgatgcgcccgcgaacgaggcgccgctgctgtcggtattcggcggcaag
atcacgacttttcgcaagctcgccgagcaggccgtcgatacgctcaccgatgcgctgcac
catggcgcgccagcgtggaccgccgacgcgccgctgccgggcggcgacatcgcacaggcg
aacttcaatcgcttcctcggagagttctcgcgcgaacatgcgtggctgccggcatcgctc
gcgcatcggctcgcgcgcgcgtatggcacgcgtgcgaatcgcgtgatcggtcccgcgcgc
tcacgcgccgagcttggtcgcgagttcgcgccgggtctgcacgaagccgagctggtttat
ctgcgcgataccgaatgggcgcgcaccgcgcaggacgtgctgtggcggcgctcgaagctc
ggcctgcatgtcgagccgggcacgctcgagccggtcacgcgcgacatcgacgcgtggttt
gcgcatgaaccggcccggcagagcgcatag

DBGET integrated database retrieval system