KEGG   Burkholderia sp. CCGE1002: BC1002_3207Help
Entry
BC1002_3207       CDS       T01217                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00630  Glyoxylate and dicarboxylate metabolism
bge00710  Carbon fixation in photosynthetic organisms
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01200  Carbon metabolism
Module
bge_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1002_3207
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_3207
Enzymes [BR:bge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BC1002_3207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADG17252
UniProt: D5WEH0
LinkDB All DBs
Position
2:21231..22730
Genome map
AA seq 499 aa AA seqDB search
MNDFSQPPIQPEHQARDPHNPRERYAAGVMKYREMGYWQPDYEPKETDVIALFRITPQPG
VEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVEPVPASRADEPQYFAYIAYE
LDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDK
YGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFAMEA
VSRAQAETGEVKGHYMNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAIQSMSRWAR
KHDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLSVQGY
YNVCRDAHNAVDLSRGLFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGG
TIGHPAGIQAGATANRVALEAMVKARNEGRDILREGPDVLEAAARWCTPLKQALDTWRDV
TFNYASTDTPDFAATPTAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagtcaaccgccgatccagcctgaacatcaagcgcgcgatccgcacaat
ccgcgcgagcggtacgcggcaggcgtgatgaaataccgcgagatgggttactggcaaccg
gactacgaaccgaaagagaccgacgtgatcgcgctctttcgcatcacgccgcagcccggt
gtcgaacccgaggaagccgcggccgcggtggccggcgaatcgtcgaccgcgacgtggacg
gtggtgtggaccgaccggctgaccgcctgcgacatgtatcgcgcgaaggcgtatcgcgtc
gagccggtgccggcgtcgcgcgccgacgagcctcagtatttcgcgtacatcgcgtacgaa
ctcgatctgttcgaagagggctcggtcgcgaacctgaccgcgtcgatcatcggcaacgtg
ttcggcttcaagccgctgaaggcgttgcggctcgaagacatgcgcattccagtcgcgtat
ctgaagacgtttcagggaccgccgaccggtatcgtcgtcgagcgcgaacggctcgacaag
tatgggcggccgttgctcggcgccacggtcaagccgaagctcggcctgtcgggcaagaac
tatgggcgggtggtctatgagggcctgcgcggcggcctcgatttcctgaaagacgacgag
aacatcaactcgcaggccttcatgcattggcgcgaccgcttcctgttcgcgatggaagcg
gtgagccgcgcgcaggcggaaaccggcgaggtcaaaggccactacatgaacgtgacggcc
ggcacgatggaggacatgtacgagcgcgccgaattcgcgaaggagctcggctcgtgcatc
gtgatgatcgatctcgtgatcggctggaccgcgatccagtcgatgtcgcgctgggcccgc
aagcacgacatgatcctgcacctgcatcgcgcggggcatggcacctacacgcggcaacgc
aaccacggcatctcgtttcgcgtgatcgccaaatggctgcgcatggcgggcgtcgatcat
gcgcatgcgggcaccgcggtcggcaagctcgagggcgatccgctgtcggtgcagggctac
tacaacgtgtgccgcgacgcgcacaacgcggtcgacctgtcgcgcggcctgttcttcgat
caaccgtgggccggcttgcgcaaggtgatgccggtcgcctcgggcgggattcacgcgggg
caaatgcaccaactgctcgacctgttcggcgacgacgcgatcctgcagttcggcggcggc
acgatcggccatccggccggcatccaggccggcgcgaccgcgaaccgcgtcgcgctcgaa
gcgatggtcaaggcgcgcaacgagggccgcgacattctgcgggaagggcccgacgtgctc
gaagccgccgcgcgctggtgcacgccgctcaagcaggcgctcgatacgtggcgcgacgtg
accttcaactacgcgtcgaccgatacgcccgatttcgccgccacgccgactgcggcttaa

DBGET integrated database retrieval system