KEGG   Burkholderia sp. CCGE1002: BC1002_3208Help
Entry
BC1002_3208       CDS       T01217                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00630  Glyoxylate and dicarboxylate metabolism
bge00710  Carbon fixation in photosynthetic organisms
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01200  Carbon metabolism
Module
bge_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1002_3208
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1002_3208
Enzymes [BR:bge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BC1002_3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADG17253
UniProt: D5WEH1
LinkDB All DBs
Position
2:22847..23275
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEIGLQIDYALRQGWACSVEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVRACREARPQHYIKVNAFDSVRTFETMRLSFIVNRPDVEPGFRLLRQDAQGRT
QRYSMAGYACDRPAGERYGATG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggaacgttttcttttctgcccgagctgaccgacgaggaaatcggc
ctgcaaatcgactatgcgctgcgccagggctgggcctgttcggtcgaattcaccgacgac
ccgcatccgcgcaacacgtactgggaaatgtggggcctgccgatgttcgacctgcacgac
gcggcgggcgtcttgcaagaggttcgggcctgccgcgaggcgcggccgcagcactacatc
aaggtcaacgcattcgattcggtgcgcaccttcgagacgatgcgcctgtcgttcatcgtc
aaccggccggacgtggagccgggcttccggctgctgcgccaggacgcgcaggggcgcacg
cagcgctacagcatggcgggctatgcgtgcgatcggccagcgggcgagcgttacggcgcg
acgggctga

DBGET integrated database retrieval system