KEGG   Burkholderia sp. CCGE1002: BC1002_3393Help
Entry
BC1002_3393       CDS       T01217                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00440  Phosphonate and phosphinate metabolism
bge01100  Metabolic pathways
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BC1002_3393
Enzymes [BR:bge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BC1002_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7 Reo_sigma1
Motif
Other DBs
NCBI-ProteinID: ADG17427
UniProt: D5WFN7
LinkDB All DBs
Position
2:215955..217682
Genome map
AA seq 575 aa AA seqDB search
MNAREPAFVSQSRSARLRQMLVSSELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQNDEHFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHASETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSG
GRAAGSAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIRLVVNEQHAQTGELASLVCALDKLTGDTVVSYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDTENASVRDFAWCSAADDRGLFGNKIVLRHVASGREQSSAASAAQVPHGR
WVGLLNVRGAGLERLQAVMRELQTRDDFASLDMPALLNALIEAGESIEVQYVHGHWRGVN
DLDDFRRAGDFAHAQAPFATAVGGATANDAHGGAQ
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaacccgctttcgtttcccagtcccgcagcgcgcgcctgcgccagatg
ctcgtcagcagtgaactcgaattcatgatggaggcgcataacggcctgtccgcgcgcatc
gttcgcgaagctgggttcaaggcgatatggggctcgggtcttgcgatctccgcgcagttc
ggcgtacgcgacaacaacgaggcgagctggacgcaggtcgtcgatacgctcgaattcatg
gccgacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaac
aatgtgcgccgcctcgtgcgcaagctggaacagcgcggcatcgcgggcgtgtgcatcgag
gacaagcagtttccgaagaccaacagcttcatcaatggcgaggcgcagccgcttgccgat
atcgacgaattctgcggcaagatcaaggccggcaaggactcgcagaacgacgagcatttc
tcgatcgtcgcgcgtgtcgaggcgctgatcgcgggctggggcatggacgaagcgctgcgc
cgggcggaagcgtatcgacgggccggcgcggatgcgatcctgattcacagcaagctgtcg
cgtcccgacgagattctcgaattcgcgcgcgaatgggccggccgcgcgccgctcgtgatc
gtgccgaccaagtactacagcacgccgaccgaggtgttccgcgaagcgggcatcagcacc
gtgatctgggcaaaccatctgatccgcgcggcgacctcggcgatgcaggccgtcgcgaag
gaaatccatgcgagcgagaccctcgtcaacgtcgaggacagcatcgccgcggtcaacgaa
atcttccgtttgcaggacgccgacgaatattcggaggccgaagaccgctatctgtcgggc
ggtcgcgcagccggctcggccgtcgtgctcgccgcgagccgcggcaagggccttgaagcg
gtgaccgaggaccgtccgaaggtgatgctgccgatcgccggcaaaccgctgctgcggtgg
ctcgtcgatgcgttcaagaagcagggcgtcaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgataccgcgggcatccgcctcgtcgtcaacgagcagcacgcgcagacc
ggcgagctcgcgtcgctcgtatgcgcactcgataaactgaccggcgacaccgtcgtttcg
tacggcgacctgctgtttcgcagctacatcctgcgcgatctggtggaaagcgaggcggcc
ttcagcgtggtcgtcgattcgtcgctgaccgatacggagaacgcgagcgtgcgagatttc
gcgtggtgctcggccgccgacgaccgtggtctgttcggcaacaagatcgtgctgcggcat
gtcgcgagcgggcgggagcagtcgtcggcggcgagcgccgcgcaggtgccgcatggccgc
tgggtgggtctgctgaatgtgcgcggcgcaggtcttgaacgcctgcaagcggtgatgcgc
gagttgcagacgcgcgacgatttcgcgtcgctcgacatgcccgcgctgctgaacgcgctg
atcgaagcgggcgagtcgatcgaggtgcaatacgtgcacggccactggcgcggcgtcaac
gatctcgacgatttccgccgcgcgggcgacttcgcgcacgcgcaggcgccgttcgcgacg
gccgtcggcggcgcaacggcgaacgatgcacacggaggcgcgcaatga

DBGET integrated database retrieval system