KEGG   Paraburkholderia sp. CCGE1002: BC1002_3985Help
Entry
BC1002_3985       CDS       T01217                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bge  Paraburkholderia sp. CCGE1002
Brite
KEGG Orthology (KO) [BR:bge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1002_3985
Enzymes [BR:bge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BC1002_3985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like K_oxygenase Glutaredoxin DAO FAD_oxidored FAD_binding_3 Thi4 FMO-like NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADG17993
UniProt: D5WHP8
LinkDB All DBs
Position
2:complement(864743..866335)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKSYLEKVSRPIELVASIDDSAKSQELLALLNDIATLSERVTVIERRGDDE
RKPSFSIGEAGKEGGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGET
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKAYDVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLLEFGATLRADEVLQRKLRSLPNVTIVTQAQTTEITGDGKKV
NGLVYKDLASGEVKNVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRHSEEVAAVSEAEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccaatctcaagactcaactgaagtcgtatctcgaaaaagttagcaggcct
atcgagctcgtcgcatcgatcgacgacagtgcgaagtcgcaggagctgctggccctgctg
aacgacatcgcgactctgtcggagcgcgtgacggtgatcgagcgtcgcggcgacgacgag
cgcaagccgtcgttttcgatcggcgaagcgggcaaggaagggggcattcgtttcgccggc
attccgatggggcatgaattcacgtcgctcgtcctcgcactgctgcaggtcggcggccat
ccggtcaaactcgacgatgcggtgatcgaacagattcgcagcctcgacggcgactatcaa
ttcgaaacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgttgatcaatccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggcggtaccgacgatgttcctgaacggcgaaacc
ttcggccagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacaccaacgccggt
gcgcgcgccgcgaaggaactggaaaagaagccggtgttcgatacgctgatcgtcggcggc
ggcccggcgggcgctgcggcggcgatctactcggcacgcaagggcattgcaactggcgtc
gtggcagagcgtttcggcggccaggtgctcgatacgttggcgatcgaaaacttcgtgtcg
gtgaccgaaaccgaaggaccgaagttcgcgaccgcgctcgaacagcacgtgaaggcctat
gacgtcgacatcatggacgtgcagcgtgccgaagcgctgattccggggcgcatcaacgaa
gtgcgtctggcgaacggcgcggtgctgaaggcgaagacgatcatcctcgcgaccggcgcg
cgctggcgcgaaatcaatgtgccgggcgagcgcgagtaccgcaatcatggcgtcgcgtac
tgcccgcactgcgatggcccgctgttcaagggcaagcgcgtcgcggtgatcggcggtggc
aactcgggcgtcgaagcggcgatcgacctcgcgggtattgtgcgcgaagtaacgctgctc
gaattcggcgcgacgctgcgtgccgacgaagtgctgcaacgtaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagaccacggaaatcaccggcgacggcaagaaggtc
aacggtctggtctacaaggacctcgcttcgggcgaagtgaagaacgtcgaactcgaaggc
gtgttcgtgcagatcggtctcgtgccgaacaccgaatggctgaagggcacggtcgagctg
tcgaagcatggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgccgggcgtgttc
gccgccggcgacgtgaccacggtgccgttcaagcagatcgtgatcgcggtgggcgaaggc
gcgaaggcatcgctgtccgcgttcgatcacctgatccgccatagcgaagaagtcgcggcg
gtcagcgaagcggaagccgaagcagcggtttga

DBGET integrated database retrieval system