KEGG   Burkholderia sp. CCGE1002: BC1002_6503Help
Entry
BC1002_6503       CDS       T01217                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00500  Starch and sucrose metabolism
bge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1002_6503
Enzymes [BR:bge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BC1002_6503
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BC1002_6503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ADG20346
UniProt: D5WMA0
LinkDB All DBs
Position
3:complement(996761..998425)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNTIIYCLSVGTFMDANGDGVGDFQGLMRRLDYLQGLGMTTIWLMPFHPSPGR
DNGYDVCDYYNVDPKYGTLGDFAEFTHACAQRGLRVIIDLVVNHTSDQHPWFLEARSDPA
SKYRDWYVWSDDKPPDAQRGVAFPGVQKSTWSFDKRARRWYFHRFYDFQPDLNTSNPHVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPMVRRHAEQYDMLRTFREFLQWREGDAII
LAEANVLPKSDLQYFGDEGERMPMMFNFRVNQNTFYTLATGNTKPLKDALLATKPRPPTA
QWGVFLRNHDELDLGRLTPAQRASVFAAFAPDPDMQLYGRGIRRRLAPMLSGDRRRLELA
YSLMLSLPGTPVFRYGDEIGMGDDLRRPERQCARTPMQWSGEPQGGFTSHSNPPVPAIAG
GAYGFERVNVAKQRRDPDSFLNWTERMVRMRREVPEISWGDFEVLPTSRNDVLALCYHWR
NNSVLFLHNFRAEACTVEFRLSSNEPGRDSLINLLSDDHSDADDDGCHTVVLEPFGYRWY
RVGGLDYLLRRTEV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgacctctggtacaagaacacgatcatttattgcctttcggtaggcaccttc
atggatgcgaacggcgacggcgtcggcgacttccagggcctgatgcgcaggctcgattac
ctgcaagggctcggcatgacgacgatctggctgatgcctttccacccgtcgccaggacgc
gataacggctacgacgtttgcgactattacaacgtcgatccgaagtacggcacgctcggc
gatttcgccgagttcacgcatgcgtgcgcccagcggggcttacgcgtgatcatcgacctc
gtggtcaatcacacgtccgaccagcatccatggttcctggaagcacgcagcgatcccgct
tcgaaatatcgcgactggtatgtctggtcggacgacaaaccgcccgacgcgcaacgcggc
gtggcgtttcccggcgtgcagaagtcgacctggagtttcgacaagcgggcaagacgctgg
tacttccatcgtttctatgattttcaaccggatctgaatacctccaatccgcatgtgcag
gcggagttgctgaagatcatgggcttctggatccagctcggagtgtccggattccgcatg
gacgcggtgcccttcgtcatcgcgacgaagggcccgatggtgcgccgccacgccgagcaa
tacgacatgttgcggacgtttcgcgagtttctgcagtggcgcgaaggcgacgcgatcatt
ctggccgaagccaacgtgctgcccaaatcggatctccagtacttcggagacgagggcgag
cgcatgccgatgatgttcaacttccgcgtcaatcaaaacacgttctacacgctcgcgacg
ggcaacacgaagccattgaaggacgcgctgcttgcgacaaagccacggccgccgactgcg
caatggggtgtgtttctgcgcaatcacgacgaactcgatctgggccggctgacgcccgct
cagcgcgcgtctgtgttcgccgcgttcgccccggaccccgacatgcaactgtatgggcgc
ggcatccgccgcagactcgcgccgatgctgtcgggcgacagacgccgtcttgaacttgcc
tacagcctgatgctgagtttgccgggcacgcccgtgttccggtacggcgatgaaatcggc
atgggcgacgatctgcgccggcccgagcgccagtgtgcgcgcacgccgatgcaatggtcg
ggcgagccgcaaggcggtttcaccagccattcaaatccgcccgtcccggcgatcgccggc
ggggcgtatggcttcgagcgggtcaacgtggcgaagcagcgacgcgatcccgattcgttt
ctcaactggaccgagcggatggtccgcatgcgccgcgaagtgccggaaatcagctggggg
gacttcgaagtgctgcccacctcgcgaaacgatgtgctcgccctctgttatcactggcgt
aacaactccgtgctgtttctgcataacttccgcgccgaagcgtgtaccgtcgaattccgc
ctgagctccaacgaaccaggccgggattcgctgatcaatcttctgtccgacgaccacagc
gacgctgacgatgacggctgtcacacggtggtgctcgagccgttcggataccgatggtat
cgggtaggcggcctcgactatctgctcaggcggaccgaggtctag

DBGET integrated database retrieval system