KEGG   Burkholderia sp. CCGE1003: BC1003_0049Help
Entry
BC1003_0049       CDS       T01314                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00010  Glycolysis / Gluconeogenesis
bgf00620  Pyruvate metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1003_0049
   00620 Pyruvate metabolism
    BC1003_0049
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BC1003_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ADN56057
UniProt: E1T409
LinkDB All DBs
Position
1:57529..59049
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGEPFTSIPRSREADVEL
ALDAAHRAKAAWGKTSTTDRANILNRIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGAVRAQEGSISEIDDDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLVELIQDLLPAGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNQDDSYFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDMKTMIGAQASQEQLEKILSYVDLGK
QEGAECLIGGERNVLGGELSKGYYVKPTVFRGNNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggagatgcagtttctgacgaccgaattcccgtacaaaaagcagtatgcg
aactttatcggcggggaatgggtgaaacccgtggggggcgagtacttcgacaacgtatcg
cctatcaccggcgagccgttcacctcgattccgcgctcgcgtgaagcagacgtggaactc
gcgctggatgcagcgcatcgcgcgaaggccgcgtggggcaaaacgtcgacgacggatcgc
gcaaacattctgaaccgcattgccgatcgcatggaagcgaacctgcaacgccttgcggtt
gccgaaacgatcgacaacggcaagccgctgcgcgagacaatggccgcggacattccgctt
gccatcgaccacttccgctacttcgccggcgccgtgcgcgcgcaggaaggctcgatctcc
gagattgacgacgacaccgtggcctatcattttcacgagccgctcggcgtggtcggccag
atcattccgtggaatttcccgatcctgatggcggtatggaagcttgctcccgcgctcgca
gccggcaattgcgtcgtgctcaagccagctgagcaaacgcccgcgtcgattctcgtactg
gtcgaactgattcaggatctgctgcccgccggcgtgctcaacgtggtgaacggtttcggt
ctggaagcgggcaaaccgctcgcctcgagcaagcgcatcgcgaagatcgcgttcacgggc
gaaaccacgacgggccgcctcatcatgcagtacgcgagccagaacatcattccggtcacg
ctggaactgggcggcaagagcccgaacattttctttgccgacgtgatgaatcaggacgac
agctacttcgacaaggcgctggaaggcttcgcgatgttcgcgctgaaccagggcgaagtg
tgcacgtgtccgtcacgcgtgttgatcgatgaaaagatctacgaccgcttcatggaacgt
gcattgaagcgcgtcgcggccatcactcaaggtcatccgctggatatgaaaacgatgatc
ggcgcacaggcttcgcaggagcagttggagaaaatcttgtcgtatgtcgatctcggcaag
caggaaggcgccgagtgcctgattggcggcgaacgcaacgtgctgggcggtgagctgagc
aagggctattacgtgaagccgaccgtgttccgcggcaacaacaaaatgcgcatcttccag
gaagagattttcgggccggtggtttccgtcaccacgttcaagaccgaagaagaagcgctc
gagattgccaacgacacgctgtacggcctgggcgccggcgtctggacgcgcgacggcacg
cgtgcctatcgctttggccggcaaattcaggcaggccgcgtgtggaccaattgctatcac
gcgtacccggcccacgccgcgttcggcggctacaagcaatcgggcattggccgcgaaaat
cacaagatgatgctcgaccactatcagcagaccaagaacctgctcgtcagctatagcgag
aaaccgctcggctttttctaa

DBGET integrated database retrieval system