KEGG   Burkholderia sp. CCGE1003: BC1003_0090Help
Entry
BC1003_0090       CDS       T01314                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00970  Aminoacyl-tRNA biosynthesis
bgf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BC1003_0090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bgf03029]
    BC1003_0090
Enzymes [BR:bgf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BC1003_0090
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BC1003_0090
Mitochondrial biogenesis [BR:bgf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BC1003_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADN56095
UniProt: E1T4N1
LinkDB All DBs
Position
1:100880..102367
Genome map
AA seq 495 aa AA seqDB search
MHEKSLTELRAALAARECSAVELAQLYLKRIDAAAGLNAFIQVDPELTLAQAKAADALLH
SGHGGPLTGVPVAHKDVFVTKGWRSTAGSKMLSNYESPFDATVVERLQTAGMVCVGKTNM
DEFAMGSSNENSYFGPVKNPWDRQAVPGGSSGGSAAAVAARLVPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATLLNAMAGFDSRDSTSLVRD
DEDYTRYLGEPWKQGDAGKPLAGLRIGLPKEYFGAGLADDVRAAIDAALKQYEALGATLV
EVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAEYRDLLDMYKKSRAEGFGPEV
KRRIMVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQQAFTQCDVIMGPVAPSVAWDLGAKG
DDPVQMYLADVYTLSVSLAGLPGMSVPCGFGAGANAQRPVGLQIIGNYFNEARMLQVADA
FQRATDWHRKAPAGV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaaaagtttgaccgaactgcgcgccgcgctggcggcgagggaatgctccgca
gtcgagctggcgcagctttatctgaagcgcatcgacgcggctgcgggcctgaatgcgttc
attcaggtggaccccgaactgacgctcgcccaggccaaagcggcggacgcgctgctgcac
tctggtcacggcggtccgctgaccggcgtgccggtcgcgcacaaggacgtgttcgtcacg
aagggttggcgctccaccgccggctcgaaaatgctgtcgaactacgaaagcccgttcgac
gccaccgtggtcgagcggctgcagacggccggcatggtgtgtgtcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgaaaattcgtattttggtcccgtgaaaaacccg
tgggatcgtcaggcggtgcccggcggctcgtcgggcggctccgctgcggccgtcgccgct
cgccttgtgcctgcggcaaccggtacggataccggcggctcgatccgtcagccggcgtcg
ttctcgggcatcaccggcatcaagccgacttacggccgcgtgtcgcgctacggcatgatc
gcgttcgcctcgtcgctcgaccagggtggcccgatggcgcaaagcgccgctgactgcgca
acgctgctcaacgccatggccgggttcgacagtcgcgattccaccagcctcgtgcgcgac
gatgaagactacacgcgctacctcggcgagccgtggaagcagggtgacgcaggcaagccg
ctcgccggcctgcgcatcggcttgccgaaggagtattttggcgccggtcttgcagacgac
gtgcgcgcggccatcgacgccgcgctgaaacaatacgaggcgcttggcgccacgctcgtc
gaagtgtcgctgccgaaaaccgagctgtccattcccgtgtattacgtgatcgcgcccgct
gaggcgtcgtccaatctgtcgcgctttgacggcgtgcgcttcggccatcgtgccgcggag
taccgcgacctgctcgacatgtacaagaaatcgcgcgcggagggcttcgggcccgaggta
aagcgccgcatcatggtcggcgcctacgtgctgtcgcatggctactacgacgcgtattac
ctgcaggcgcagaaaattcgccgcatcatcgcgcaagatttccagcaggcgttcacccag
tgcgacgtcatcatgggaccggttgcgccttctgtggcatgggatctgggcgcgaagggc
gacgatccggtgcagatgtatctcgccgatgtctacacgctgtcggtcagcctcgccggc
ctgccgggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcccagcgcccggtc
ggtttgcagatcatcggcaattatttcaatgaagcccggatgctgcaggtggccgacgcg
ttccagcgcgcgaccgactggcaccgcaaggcaccggcaggagtgtga

DBGET integrated database retrieval system