KEGG   Burkholderia sp. CCGE1003: BC1003_1908Help
Entry
BC1003_1908       CDS       T01314                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
bgf  Burkholderia sp. CCGE1003
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADN57874
UniProt: E1T9Y6
LinkDB All DBs
Position
1:complement(2203764..2205188)
Genome map
AA seq 474 aa AA seqDB search
MKTYDKLYIDGKWIAPCGTGTIDVIDSGTEQVMGRIPEGVEADAESAIAAARVAFDGWAA
TSAAQRGDYLERIAANLKARTDELAALIAGEVGMPLKLARAIQVGSPVYNWSAYAQLARS
FEFEKRVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVVLKPSEVAPLNAF
VLAEVIHEAGLPAGVFNLVSGYGPVVGEVLASHPSVDMVSFTGSTRAGKRVSELASATVK
RVALELGGKSASVILDDADFAAAVKGTVSACFLNSGQTCSAHTRMLVPEARYDEARALAK
QAAESYMPGDPRDEQTRLGPLASAVQQARVQQYIAKGIEEGAELVTGGAGLPDGVSKGFF
VKPTVFGRVHPKATIAQEEIFGPVLSILTYKDEEEAIRIANDSPYGLGGAVWAGSDERAQ
AVARRLRTGQVDINGGAWNMAAPFGGFKQSGFGRENGVYGLEEYLEFKSMQFKV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacgacaaactctatatcgacggcaaatggatcgcgccgtgcggcaccggc
accatcgacgtgatcgactccggcaccgagcaggtgatgggacgcatccccgaaggcgtc
gaggccgacgccgaaagcgcaattgcggccgcgcgcgtcgccttcgacggctgggccgcc
acgagcgccgcacagcgcggcgactatctggagcgcatcgcggcgaacctgaaagcacgc
acggacgagctggccgcgctgatcgcaggcgaagtcggcatgccgctgaagctcgcgcgc
gcaatccaggtgggcagccccgtctacaactggagcgcgtatgcgcagcttgcgaggagc
ttcgagttcgagaagcgcgtcggcaattctctggtcgtgcgcgagccggtcggcgtggtc
gcggcaatcacaccttggaactatccgctcaatcagattacgctgaaggtcgcggcggcg
ctcgcggccggttgcaccgtggtgctcaaaccgtcggaggtcgcgccgctcaatgcgttc
gtgttggcggaggtgattcacgaagccgggttgcccgccggcgtgttcaacctggtgagc
ggttacgggccggtggtcggagaagtgctggcgagccatccatcggtggacatggtgtcg
ttcacaggctcgactcgcgcgggcaagcgcgtgtcggaactggcgtcggcgacggtcaag
cgagttgcgctcgaactgggcggcaagtcggcgtccgtcattctcgacgacgccgatttt
gccgccgccgtgaaaggcaccgtgagcgcctgctttctgaactcggggcagacgtgctcc
gcgcacacgcgcatgctggtgcccgaagcgcgctacgacgaagcacgcgcgctcgcgaaa
caggcggccgagagctatatgccgggcgacccgcgcgatgaacaaacgcgtctcgggccg
ctcgcgtccgcggtgcagcaggcacgcgtgcagcagtacatcgcgaagggtatcgaggag
ggcgcggaactggtgacgggcggcgcggggctgcctgatggcgtgtcgaaaggctttttc
gtcaagccgaccgtgttcggccgcgtgcatccgaaggcaacgatcgcgcaagaagaaatc
ttcggcccggtgctctccattctgacctacaaggacgaagaggaagcgattcggattgcc
aacgattcgccctacggactcggcggcgcggtatgggccggcagtgacgagcgggcgcaa
gccgttgcgcgccgcctgcgcacgggccaggtggacatcaacggcggcgcgtggaatatg
gcagcgccgttcggcggcttcaagcaatcgggctttggccgcgagaacggcgtgtacggt
ctcgaggaatatctcgagttcaagtcgatgcaattcaaagtgtga

DBGET integrated database retrieval system