KEGG   Burkholderia sp. CCGE1003: BC1003_2756Help
Entry
BC1003_2756       CDS       T01314                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00020  Citrate cycle (TCA cycle)
bgf00480  Glutathione metabolism
bgf01100  Metabolic pathways
bgf01110  Biosynthesis of secondary metabolites
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
bgf01200  Carbon metabolism
bgf01210  2-Oxocarboxylic acid metabolism
bgf01230  Biosynthesis of amino acids
Module
bgf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC1003_2756
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1003_2756
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BC1003_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADN58709
UniProt: E1T7J6
LinkDB All DBs
Position
1:complement(3224887..3226143)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPTGGDKITVNADFSLNVSDQPIIPFIEGDGTGLDITPVMIKVVDAAVEKAYA
GKRKIQWMEIYAGEKSTRVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWPAESEQARKVIKF
LQEEMGVKKIRFPETSGIGIKPVSREGTERLVRKAIQYAIDNDRRSVTLVHKGNIMKYTE
GAFRDYGYALAQKEFNAELIDGGPWMKVKNPKTGGDIVVKDVIADAFLQQILLRPAEYDV
IATLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWVEAADLIIKSMETSILQKRVTYDFARLMEGATQVSCSGFGQVMIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccgaccggtggtgacaagatcaccgtcaacgcggat
ttctcgctcaacgtttcggatcagccgatcattccgtttatcgaaggcgacggcaccggt
ctcgacatcacgcccgtcatgatcaaggtcgtggacgcggcggtcgaaaaagcctacgcg
ggcaagagaaaaatccagtggatggaaatttatgcgggcgaaaaatcgacgagggtctac
ggcccggacgtgtggctgcccgaagaaacgctgcaggtgctgaaggaatacgtggtatcc
atcaaggggccgctgactacgcccgtgggcggcggcatccgttcgctgaacgtcgcgctg
cgtcaggaactggacctgtacgtatgcctgcgacccgtgcagtacttcaaaggcgtgccg
tcgccggtgcgcgagccggagaaaaccaacatggtgatcttccgcgagaattcggaagac
atctatgcgggtatcgaatggccggccgaatcggagcaggcgaggaaggtcatcaagttc
ctgcaggaagaaatgggcgtgaagaagatccgctttccggaaacctcgggaatcggcatc
aagccggtgtcgcgcgagggcacggagcgtctggtgcgcaaggcgatccagtatgcgatc
gacaacgaccgccgctcggtcacgctcgtgcacaagggcaacatcatgaagtacacggaa
ggcgctttccgtgactatggctatgcgctcgcgcagaaggaattcaacgccgagctgatc
gacggcggcccgtggatgaaggtgaagaatccgaagacaggcggcgacatcgtggtgaaa
gacgtgattgccgacgctttcctgcagcagatcctgctgcgtcccgcggaatacgacgtg
atcgccacgctgaatctgaacggcgactacgtgtcggacgcactcgccgcgcaggtgggc
ggcatcggcattgcgccgggcgcgaacatgtccgattcggtcgcgatgttcgaagccact
cacggcaccgcgccgaagtacgcgggcaaagactacgtgaatccggggtcggaaattctc
tcggcggaaatgatgctacgtcacctgggctgggtcgaggcggcggatctgatcatcaag
tcgatggaaacgtcgattctgcaaaagcgcgtcacttacgacttcgcgcgccttatggaa
ggcgcgacgcaggtttcctgctcgggcttcgggcaggtgatgatcgagaatatgtaa

DBGET integrated database retrieval system