KEGG   Burkholderia sp. CCGE1003: BC1003_3665Help
Entry
BC1003_3665       CDS       T01314                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00500  Starch and sucrose metabolism
bgf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC1003_3665
Enzymes [BR:bgf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BC1003_3665
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BC1003_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase THB
Motif
Other DBs
NCBI-ProteinID: ADN59605
UniProt: E1TI97
LinkDB All DBs
Position
2:complement(157288..158952)
Genome map
AA seq 554 aa AA seqDB search
MLNDLWYKNAIVYCLSVGTFMDADGDGVGDFRGLLRRLDYLQGLGVTTIWLMPFQPSPGR
DNGYDICDYYNVDPKYGTLGDFSEFTHACRERGLRVMIDLVVNHTSDQHPWFRQARSDPG
SQYRDWYVWSDRQPPNAKDGVVFPGVQKSTWTFDKQAKRWYFHRFYDFQPDLNTSNPYVQ
AELLKIMGFWIQLGVSGFRMDAVPFVIATKGPKVRKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPNTDLDYFGDAGERLQMMFNFQLNQNTFYTLATGDTAPLKKALTATRPRPPTA
QWGVFLRNHDELDLGRLTPEQREAVFAAFAPEPDMQLYERGIRRRLAPMLAGDRRRLELA
YSLMLTLPGTPVFRYGDEIGMGDDLSLPERECARTPMQWSTEPHGGFTKNPKPPCRVITG
GAYGFERINVATQRRDPNSMLNWMERMIRMRREVPEISWGDFEVLRVSRGDVLALRYDWR
NNSVLCLHNFGAEACTVRFRSGCTEPGQNRLINLLSDDHSEENDDGRHAVVLEPYGYRWY
RVGGLDYLLRRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgacctctggtacaagaacgccattgtctactgcctctcggtaggcacgttc
atggacgccgatggcgacggcgtgggcgacttcaggggcctgttgcgccgcctcgactac
ctgcaaggcctcggcgtgacgacgatctggctcatgccgttccagccttcgccgggccgc
gacaacggctacgacatttgcgactattacaacgtcgacccgaaatacggcacgctcggc
gacttctccgaattcacgcatgcgtgccgcgaacgcggcctgcgtgtgatgatcgatctg
gtcgtcaatcacacgtccgatcagcacccctggttcaggcaagcacgcagcgatcccggc
tcgcagtatcgcgactggtacgtgtggtccgaccgccagccgcccaatgcaaaagacggc
gtggtgtttcccggcgtgcagaaatccacatggactttcgacaagcaggcaaagcgctgg
tatttccaccgcttctacgacttccagcccgacctgaacaccagcaacccatacgtgcag
gccgaattgctgaagatcatgggcttctggatccagctcggcgtgtcggggttccgcatg
gacgccgtgcccttcgtgatcgcgactaaaggtcccaaggtgcgcaagccggtcgagcaa
tacgacatgttgcgcgcgtttcgcgagtttttgcagtggcgtcagggcgacgcgatcatc
ctcgccgaggccaacgtgctgcccaatacggacctcgactatttcggcgacgcgggcgag
cgtttgcagatgatgttcaatttccagctcaaccagaacaccttctacacgcttgcaacc
ggcgatacggcacccttgaagaaagcactgacggcaacgaggccgcgtccgccgactgcc
caatggggcgtgttcctgcgcaaccacgacgagctcgatctgggccgcctgacgcccgag
cagcgcgaggccgtgttcgccgcgttcgcgccggagcccgacatgcagctctacgagcgc
ggcatccgccgccgcctcgcgccgatgctcgcgggcgacagacgccggctcgagctcgca
tacagcctgatgctgaccttgcccggcacgccggtcttccgttacggcgacgaaatcggc
atgggcgacgacctgagcctgcccgagcgcgaatgcgcgcgcacgccgatgcaatggtcg
acggaaccgcacggcggcttcaccaagaaccccaagccgccgtgccgcgtgatcacgggc
ggcgcttatggctttgagagaatcaacgtggcgacccagcggcgcgatccgaattccatg
ctcaactggatggagcgcatgatccgcatgcgccgcgaagtgccggagatcagttggggc
gacttcgaggtgctgcgcgtgtcgcgcggcgatgtgctcgcgcttcgttacgactggcgc
aacaactcggtgctgtgcctgcataacttcggcgccgaggcttgcacggtgcgctttcgc
tcgggctgcacggagcctggccagaaccggctcatcaaccttctctcggacgatcacagc
gaggagaacgacgacggccgccatgcggtggtgctcgagccttatggataccgctggtat
cgcgtgggcgggctcgactatctgttaagacgcagcgaaatctga

DBGET integrated database retrieval system