KEGG   Burkholderia sp. CCGE1003: BC1003_3762Help
Entry
BC1003_3762       CDS       T01314                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bgf  Burkholderia sp. CCGE1003
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BC1003_3762
Enzymes [BR:bgf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BC1003_3762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin K_oxygenase DAO Thi4 FAD_binding_3 FMO-like NAD_binding_8 FAD_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADN59702
UniProt: E1TIZ2
LinkDB All DBs
Position
2:complement(269527..271119)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVSVVERRDDSE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIVTGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSEVTLFEFGANLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGEVKKVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRSSEETEAVSEVEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcagttgaaaacgtacctcgaaaaggttagcaggcct
atcgagatcgtcgcgtcgctggacgacagcgcgaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggaacgcgtgagcgtggtggagcgtcgcgacgacagcgaa
cgcaagccgtcgttttcgatcggcgagccgggcaaggacatcggcatccgcttcgctggc
attccgatggggcatgaattcacgtcgctcgtgctggcattgctgcaggtgggcggccat
ccggtcaaactcgacgacgcggtaatcgaacaaatccgcagtctcgacggcgactatcaa
ttcgaaacgtatttctcgctgtcgtgccagaactgtccggaagtcgtgcaggcgctcaat
gtgatggcgctcatcaacccgcgcattcgtcacgtggcaattgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggctgtgccgaccatgttcctgaacggcgaagtg
ttcggccaggggcgcagcggcgtgaaggaaattctcgcgaagctcgataccaacgccggt
gcgcgtgccgcgaaagaactggaaaagaagccggtgttcgacacgctcatcgtcggcggc
gggcctgctggtgcggctgcggcaatctattcggcgcgcaagggcattgtcaccggcgtg
gtggcggaacgcttcggcggccaggtgctcgacacgctcgctatcgaaaactttgtgtcg
gtcacggaaacggaaggcccgaagttcgccacggcgctcgagcaacacgtgaagacgtat
gaagtcgacatcatggacgtgcagcgcgccgaagcgttgattcccggccgcatcaacgag
gtgcgtcttgcgaacggcgcggtgctgaaagcgaagacgatcattctcgcaaccggtgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcaatcacggcgtggcgtac
tgcccgcactgcgacgggccgctcttcaagggcaagcgcgtcgcggtgatcggcggcggc
aactcgggcgtggaagccgcaatcgacctcgcgggtattgtgagcgaagtgacgctgttc
gaattcggcgccaacctgcgtgcggacgaagtgttgcaacgcaagctgcgcagcctcgcc
aacgtgacgatcgtcacgcaggcgcagaccaccgaaatcaccggcgacggcaagaaggtg
aacgggctcgtctacaaagacctgcgttcgggcgaagtgaagaaggtggaactggaaggc
gtattcgtgcagatcggtctggtgccgaacaccgagtggctcaagggcacggtcgagttg
tcgaagcacggcgagattgtcgtcgacgcacgcggcgcgacgtcggtgccgggcgtgttc
gccgcaggcgacgtgaccacggtgccgttcaagcagatcgtgattgcagtgggcgagggc
gcgaaggcatcgctcagcgcgttcgatcacctgatccgcagcagcgaagaaaccgaagcg
gtcagcgaggtggaagcagaagcggcggtttga

DBGET integrated database retrieval system