KEGG   Burkholderia sp. CCGE1003: BC1003_4280Help
Entry
BC1003_4280       CDS       T01314                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00440  Phosphonate and phosphinate metabolism
bgf01100  Metabolic pathways
bgf01120  Microbial metabolism in diverse environments
bgf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BC1003_4280
Enzymes [BR:bgf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BC1003_4280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ADN60214
UniProt: E1TEQ9
LinkDB All DBs
Position
2:complement(865667..867391)
Genome map
AA seq 574 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVGNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMEEALR
RAEAYRLAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHTSETLVNVEDRIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTQDRPKVMLPVAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNDRHAETGELASLACALDKLSGDTVISYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVVLRHVSSGQEASSAIAAQTPHGRW
VGLLNVRGAGRERLQTVMRELQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHGQTPLAASVGGADADAANGAAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcttttgtttccgcttcacgcagcgcgcgcctgcgccagatg
ctcgtgagcaacgaactcgaattcatgatggaagcccataacggcctttcggcgcgcatc
gttcgcgaggccggcttcaaggcgatctggggctcggggctcgccatctccgcgcaattc
ggcgtgcgcgacaacaacgaagccagttggacccaggtggtcggcaacctcgaattcatg
gccgacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccgtctggtgcgcaagctcgagcagcgcggcattgccggcgtgtgcatcgaa
gacaagcagtttccgaaaaccaatagcttcatcaacggtgaggcgcagccgcttgccgac
atcgacgaattctgcggcaagatcaaggccggcaaagactcgcagtcggacgagaacttt
tcgattgtcgcgcgcgtggaagcgctgatcgcgggctggggcatggaagaggcgttgcgc
cgcgcggaagcctaccgcctcgccggtgcggacgccatcctgattcacagcaagctctcg
cggcccgacgaaattctggagttcgcgcgcgaatgggccggccgcgcgccgctcgtcatc
gtgccgaccaagtactacagcactccgacagaagtgttccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcaacctccgcgatgcaggcggtggcgcgc
gagatccatacgagcgaaacgctcgtgaacgtcgaagaccgcatcgcggccgtcaacgag
attttccgtttgcaggacgccgacgaatattcggaagccgaagaccgctatctgtcgagc
ggccgggcggcgggctccgccgtcgtgctcgcggcgagccgcggcaagggcctcgaggcc
gtcacgcaagaccgcccgaaagtcatgctgccggtggccggcaagccgctgttgcgctgg
ctcgtcgacgcattcaagaagcagggcgtcaacgacatcaccgtggtcggcggttatcgc
gccgatgcgatcgacacggccggcatcaagctggtcgtcaacgacaggcatgccgagacg
ggcgaactcgcgtcgctcgcgtgcgcgctcgacaagctctccggcgacaccgtgatttcc
tacggcgatctgctgttccgcagctacattctgcgcgatctggtggagagcgaagcggcg
ttcagcgtggtggtggattcttcgctgaccgacgcggaaaacgcgagcgtgcgcgacttc
gcgtggtgctcagctgccgacgaccgcggtctgttcggcaacaaggtggtgctgcgtcat
gtgtcgagcgggcaggaggcgtcgtcggcaatcgctgcacaaacgccgcatggccgctgg
gtcggtcttctgaacgtgcgcggcgcaggccgcgagcgtctgcagaccgtgatgcgcgag
ttgcaggcgcgcgccgatttcgcgtcgctcgacatgcccgcgttgctgaacgcgctgatc
gaagccggtgagtccatcgaggtgcagtacgtgcacggccactggcgcggcgtcaacgat
ctggaagacttccgccgcgcgggcgacttcgcgcacgggcagacgccgctcgcggcgtcc
gtcggcggtgcggacgctgacgcagcgaacggagcggcgcaatga

DBGET integrated database retrieval system