KEGG   Burkholderia sp. CCGE1003: BC1003_4827Help
Entry
BC1003_4827       CDS       T01314                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BC1003_4827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgf02000]
    BC1003_4827
Enzymes [BR:bgf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BC1003_4827
Transporters [BR:bgf02000]
 Other Transporters
  Pores ion channels [TC:1]
   BC1003_4827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADN60750
UniProt: E1TID9
LinkDB All DBs
Position
2:complement(1512539..1513216)
Genome map
AA seq 225 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPQTMLAPPELRAVHPLGKSPVITDDG
LTIAESGAIIEYLVGKYGQGRFAPAAGTPERLRYTYWLHYAEGSAMPPLLLKLVALRIAS
APMPFFAKPIARKIAGTLQSSFIDPQLKLHLGYIEKELAKSQWFAGDEFTAADVQMSFPL
EAATARGGMESQLPAVSGFLQRIHARPAYGRALERGGEYGILGGG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgactgtccatcatttgaataactcgcgctcgcagcgcgtcttgtggctgctcgaa
gagctcggcgttccttacgagatcaagcgatacgagcgcgatccgcaaaccatgcttgcg
ccgcccgagttgcgcgcggtgcatccgctcggcaagtcacccgtcattacggacgatggg
ctgaccattgccgagtcgggcgcgattatcgagtatctggtcggcaagtatgggcagggc
cgttttgcgccggccgccggcacgcctgagcggttgcgctatacgtactggttgcattac
gcggaagggtcggccatgccgccattgctgctcaagctggtggcgctgcgcattgcaagt
gcgccgatgccgttctttgcgaagcccattgcacgcaagattgcggggacgctgcagtca
agttttatcgatccgcaattgaagttgcatctgggctacatcgagaaagagttggctaaa
agccagtggtttgccggcgatgagttcactgccgcggatgtgcagatgagttttccgctc
gaggcggcgacagcgcgcggtgggatggagtcgcaacttcctgctgtaagtgggttcttg
cagcgcattcatgcgcggcctgcgtacgggcgggcgttggagaggggtggggagtatggg
attttgggtggggggtga

DBGET integrated database retrieval system