KEGG   Burkholderia sp. CCGE1003: BC1003_5265Help
Entry
BC1003_5265       CDS       T01314                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00250  Alanine, aspartate and glutamate metabolism
bgf00410  beta-Alanine metabolism
bgf00640  Propanoate metabolism
bgf00650  Butanoate metabolism
bgf01100  Metabolic pathways
bgf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1003_5265
   00650 Butanoate metabolism
    BC1003_5265
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC1003_5265
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1003_5265
Enzymes [BR:bgf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BC1003_5265
Amino acid related enzymes [BR:bgf01007]
 Aminotransferase (transaminase)
  Class III
   BC1003_5265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADN61185
UniProt: E1TDY2
LinkDB All DBs
Position
2:complement(1994748..1996037)
Genome map
AA seq 429 aa AA seqDB search
MNLKNAELKSRKDAATPRGVGVMCDFYAQRAENAELWDVEGHRFIDFAAGIAVCNTGHRH
PKIVAALRDQLDHFTHTAYQIVPYASYVELAEKLNQRAPGDHPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFTGGFHGRTLMGMALTGKVAPYKLGFGPFPSDVFHAPFPNPLHGVS
TADSLKALEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPVEFVRALRKLCNEHGILLIAD
EVQTGFARTGKLFAMHHYDVVPDLMTVAKSLAGGMPLSGVIGRADVMDAAAPGGLGGTYA
GNPLALAAAHAVLDIIDEEKLCERATVLGDRVKAKLLALQKDAPHIADVRGPGGMVAVEF
CKPGSSEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIQDAVLDEALAILEDV
IKDSVAVAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaagaacgcagaattgaagagccgcaaggacgcagccacgccgcgcggcgtc
ggcgtaatgtgcgatttttacgcccagcgcgccgaaaacgccgagctgtgggacgtggag
ggccaccgctttattgacttcgccgcgggtatcgcagtgtgcaacacgggacaccgtcat
ccgaagatcgtagcggcgctgcgcgaccagttggatcacttcacgcataccgcgtatcag
atcgtgccgtacgcgtcctacgtcgagcttgcggaaaaactcaaccagcgcgcgcccggc
gatcatccgaagaagactgcctttttcaccacgggcgccgaggctgtcgaaaacgcgatc
aagattgcgcgcgcggcgaccggacgtccaggcgtgatcgccttcacgggcggctttcac
ggccgcacgctgatgggcatggcgctcaccggcaaggtcgcgccgtacaagctcggcttc
ggcccgtttccgtccgacgtgttccatgcgccgtttcccaatccgctgcacggcgtgagc
accgctgactctctgaaagcgctcgaattcctgttcaaggcggacatcgacccgaagcgc
gtggccgcgatcatcttcgaaccagtgcagggcgaaggcggcttttatccggcgccagtc
gagttcgtgcgcgcactgcgcaagctgtgcaacgagcacggcattctgctgatcgctgac
gaagtgcaaaccggctttgcccgcaccggcaaactgttcgccatgcatcactacgacgtg
gtgcctgacctgatgacggtcgccaagagtctggcgggcggcatgccgctgtcgggcgtg
attggccgcgccgacgtgatggacgccgcggcgcccggcggcctcggcggcacgtatgcc
ggcaatccgctcgcgctcgccgccgcgcatgcggtgctcgacatcatcgacgaagaaaag
ctttgtgaacgcgccaccgttctgggcgaccgggtcaaagccaaactgctcgcgctgcaa
aaagacgcgccgcacattgccgatgtgcgcggccccggcggcatggtggccgtcgagttc
tgcaagccaggcagcagcgagccggacgccgacttcacgaagcgcgtgcaggcccgcgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtctattcgaacgtggtgcgcttcctg
ttcccattgacgattcaggacgccgtgctcgacgaggcgctcgccattctcgaggacgtg
atcaaggacagcgttgctgtcgctgcttga

DBGET integrated database retrieval system