KEGG   Burkholderia sp. CCGE1003: BC1003_5439Help
Entry
BC1003_5439       CDS       T01314                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf00710  Carbon fixation in photosynthetic organisms
bgf01100  Metabolic pathways
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Module
bgf_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bgf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_5439
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_5439
Enzymes [BR:bgf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BC1003_5439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADN61357
UniProt: E1TEV1
LinkDB All DBs
Position
2:2191304..2192803
Genome map
AA seq 499 aa AA seqDB search
MNDFSQPAIESLHKPRNAGNPRERYAAGVMKYREMGYWQPDYTPKDTDVIALFRITPQPG
VEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPASSASEPQYFAYIAYE
LDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDK
YGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENINSQAFMHWRDRFLFSMEA
VNRAQAETGEVKGHYLNVTAGTMEDMYERAEFARELGSCIVMIDLVVGWTAIQSMGRWAR
KNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLEGDPLTVQGF
YNVCREARNEVDLSRGIFFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGG
TIGHPGGIQAGAVANRVALEAMVKARNEGRDIREEGPDILEAAARWCGPLKQALDTWRDV
TFNYASTDSPDFAATPTAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagtcaaccggcgatcgagtctctccacaagccgcgcaatgctggcaat
ccgcgcgagcgctacgctgcgggcgtgatgaagtaccgcgagatgggctactggcagccg
gattacacgccgaaagacacggacgtgattgcgctctttcgcatcacgccgcagccgggc
gtcgaaccggaggaagcggccgcggcagtggccggcgaatcgtcgacggcaacctggacc
gtggtgtggaccgaccggctgaccgcatgcgatatgtaccgcgccaaggcttatcgcgtc
gatccggtgcctgcatccagcgcgagcgagccgcaatacttcgcctatatcgcatatgaa
ctcgatctgttcgaggaaggctcggtcgccaacctgaccgcgtcgatcatcggcaatgtg
ttcggcttcaaaccgctgaaagcgttgcgcctcgaagacatgcgcatacccgttgcctac
ctgaagaccttccaggggccgcccacgggaatcgtcgtcgaacgcgagcggctcgacaag
tatggccggcctctgctcggcgcaaccgtgaagccgaagctcgggctgtcgggcaagaac
tatggccgcgtcgtctatgaaggtttgcgcggcggcctggatttcctgaaggacgacgag
aacatcaattcacaggcgttcatgcactggcgcgaccgtttcctcttttcgatggaagcg
gtgaaccgcgcgcaggccgaaaccggcgaggtgaaaggccactacctgaacgtgaccgcg
ggcaccatggaggacatgtacgagcgcgccgaattcgcgagagaactggggtcatgcatc
gtcatgatcgatctggtggtcggctggaccgcgatccagtcgatgggacgctgggcgcgc
aagaacgacatgattctccatctgcatcgcgcgggacacagcacctacacgcgtcagcgc
aaccacggcatttcgtttcgcgtgatcgcaaagtggctgcgcatggcgggcgtcgatcac
gcgcatgcgggcacggcagtcggcaaactggaaggcgatccgctgacagtgcaaggcttt
tacaacgtatgccgcgaggcgcgcaacgaagtggacctgtcgcgcggcattttcttcgat
cagccgtgggccggcttgcgcaaggtgatgccggtcgcctccggcggcattcacgcgggg
cagatgcatcaactgctcgacctgttcggcgatgacgcgattctgcagttcggcggcggc
accatcggccatccgggcggcatccaggcgggcgccgtggccaaccgcgtcgcgctcgaa
gcgatggtgaaagcgcgcaacgaagggcgcgacatccgcgaggaagggccggacattctc
gaagccgcggcgcgctggtgcgggccgctcaagcaggctctcgacacctggcgcgacgtg
accttcaactacgcgtcgacagattcgccggatttcgccgccacgccgacggccgcgtaa

DBGET integrated database retrieval system