KEGG   Burkholderia sp. CCGE1003: BC1003_5440Help
Entry
BC1003_5440       CDS       T01314                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bgf  Burkholderia sp. CCGE1003
Pathway
bgf00630  Glyoxylate and dicarboxylate metabolism
bgf00710  Carbon fixation in photosynthetic organisms
bgf01100  Metabolic pathways
bgf01120  Microbial metabolism in diverse environments
bgf01200  Carbon metabolism
Module
bgf_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bgf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BC1003_5440
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BC1003_5440
Enzymes [BR:bgf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BC1003_5440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADN61358
UniProt: E1TEV2
LinkDB All DBs
Position
2:2192968..2193396
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPELTDEEISLQIDYALSQGWACSVEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVKACRAARPDHYIKVNAFDSVRGFETMRLSFIVNRPQEEPGFRLTRQDGPERV
QRYGLAGYASDRPSGARYVTER
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattacacagggcacgttttccttcctgccggaattgaccgacgaggaaatcagt
ttgcagatcgattatgcgttgagccagggctgggcctgttccgtcgaattcacggacgac
ccgcatccgcgcaacacgtattgggaaatgtgggggctgccgatgttcgatctgcacgac
gcagccggcgtgcttcaggaagtcaaggcatgccgcgcggcgcggcccgatcactacatc
aaggtcaacgcattcgattccgtgcgcggcttcgagacgatgcgtctgtcgttcatcgtg
aatcgcccgcaggaggaaccgggtttccgtcttacgcgccaggacgggccagagcgcgtg
caacgttacgggctcgcgggctacgcgagcgaccggccttccggcgcacgctacgttacg
gagcgctga

DBGET integrated database retrieval system