KEGG   Brachybacterium ginsengisoli: CFK41_00650Help
Entry
CFK41_00650       CDS       T05099                                 

Gene name
hutG
Definition
(GenBank) formimidoylglutamase
  KO
K01479  formiminoglutamase [EC:3.5.3.8]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00340  Histidine metabolism
bgg01100  Metabolic pathways
Module
bgg_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CFK41_00650 (hutG)
Enzymes [BR:bgg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.8  formimidoylglutamase
     CFK41_00650 (hutG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ATG53447
UniProt: A0A291GTC5
LinkDB All DBs
Position
complement(131770..132765)
Genome map
AA seq 331 aa AA seqDB search
MTTSPEAGTPWTGRYDGDGPEHARWHQRVLQGAVGAAPDPAADHVALLGFRSDEGVRRNR
GRVGAADGPDALRRALAPMALHGPLARGEVALHDLGDAVTEGEDLEGGQAAAAALTSAAL
DRAGAQLSVVLGGGHETAWSSYQGLMGSGLGPRARQRWGVLNLDAHFDLREEPRPTSGTP
FAQMAAAEQRAGRDLHYAVLGIAEPSNTGALFDRARDLGVRWWTDEQCLEAGAEGITRFV
EEFTAELDLLYLTIDLDVLPAATAPGVSAPAAYGVPLPLIAAAVRAAAASGKLTLLDVVE
LNPSLDVDGRTARAAARLIDDAVRLVTGSEP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccccgaggccgggaccccctggaccggtcggtacgacggcgacggcccc
gagcacgcccggtggcatcagcgggtgctgcagggcgccgtcggcgcggccccggacccc
gccgccgatcatgtcgccctgctgggcttccgctccgacgagggcgtgcggcgcaaccgc
ggccgggtcggtgcggccgacggtcccgacgcgctgcgccgggcgctcgccccgatggcc
ctgcacggtccgctcgcccgcggcgaggtggccctgcacgatctcggcgacgccgtgacc
gagggcgaggacctcgagggcgggcaggcggccgccgcggcgctcacctcggcggcgctc
gaccgtgccggggcgcagctgagcgtggtgctcggcggcgggcacgagacggcgtggtcc
tcgtaccaggggctgatgggctccgggctcgggccgcgcgcccggcagcgctggggcgtg
ctgaacctcgatgcccacttcgacctgcgcgaggagccgcggcccacctccggcaccccc
ttcgcccagatggccgccgccgagcagcgcgcgggccgcgacctgcactacgcggtgctg
ggcatcgccgagccctccaacaccggagcgctgttcgaccgggcccgcgacctcggcgtg
cgctggtggaccgacgagcagtgcctcgaagccggcgcggaggggatcacccgcttcgtc
gaggagttcaccgcggagctggacctcctctacctcaccatcgacctggacgtgctgccg
gccgcgaccgctcccggggtctcggccccggccgcctacggagtcccgctgccgctgatc
gccgcggccgtccgcgccgcggccgcgagcgggaagctcaccctgctggacgtggtggag
ctgaacccctccctggatgtcgacggccgcaccgcccgcgccgccgcccgcctcatcgac
gacgcggtgcgcctggtcaccggctcggagccctga

DBGET integrated database retrieval system