KEGG   Brachybacterium ginsengisoli: CFK41_02750Help
Entry
CFK41_02750       CDS       T05099                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00230  Purine metabolism
bgg00240  Pyrimidine metabolism
bgg00760  Nicotinate and nicotinamide metabolism
bgg01100  Metabolic pathways
bgg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CFK41_02750
   00240 Pyrimidine metabolism
    CFK41_02750
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CFK41_02750
Enzymes [BR:bgg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     CFK41_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: ATG56444
UniProt: A0A291H253
LinkDB All DBs
Position
641121..643604
Genome map
AA seq 827 aa AA seqDB search
MPMLDTPARRIARGASAGLGAAALAVASAVVPVGAAAAEIGDEVTLMTINDFHGALGGAS
DLACTVETVRQDAQESFLLSAGDNVGGSSFASAVQNDEPTIDVLNALEVDASAIGNHEFD
QGQDDLKNRIEGRTDFPDLAANVYNADGTRLMEPYTVIDDGGVKVAVVGAVTTKTVGKVS
PAAIEGLDFRDPVDEVNKAIGELEADGVEYDILVASYHEGASANAEPGVAPKNTDPMFDK
IVAETDPEVDAIFNGDSHRVYNFNADVPGQDGEVRPVIQTGSSAENLGVVSLALGEDGDW
DVVGEPENRPTAQGDAGCAISTPVTEKVDQIAQDAIAEADVIGAQPVGSVATDVTTSWDD
TKASYVDGVRTADAPIGNQATTKGDNRTRHSAAGDMLADSMKWYLEDAGLAGDDEVIGFM
NPGGIRAELWYDAAGAEGDGVVTYAEANSMVPFGNTLNAGEVTGDQFIQMLEEQWQRTAD
GGAVDEGDESFLAFSVSNNVEYVFDSTRERDDRIIDVRINGESIDPDATYTIVTASFLFE
GGDNMWALSEAHNVRDSGVLDRDAFLQYLQSEDGQNLEPSYAQRQIDLQILDGGEYDSEA
GVDRDPVLRIGNVESQSLGAPEIETVQVDAGEYGTFEAPYTLDEETGRLYADVTLTDWMC
VPEGTQVPLTITAVPETGTEIVTEIGSFTWTAGGAPDECDTATPPPGDDDDDEPTTPPAT
EEPTTPAPGDGDDQGDGQGGDDQGQDQGGDDQGEDEAGGPAVIADGNGDDADDPADVIPA
EDTTAGGSDRSDLARTGVEVGPMVAAIGVISLAGVAALGLRRRMTRR
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atccccatgctggacacccccgcgcgccggatcgcgcgcggcgcgagcgccggtctcggc
gccgccgcactcgctgtcgcctccgccgtcgtcccggtcggtgccgccgccgccgagatc
ggcgacgaggtcaccttgatgaccatcaacgacttccacggcgccctcggcggcgcctcc
gacctcgcctgcaccgtcgagaccgtgcgccaggatgcccaggagtcgttcctcctctcc
gccggggacaacgtgggcggctccagcttcgcctccgccgtgcagaacgacgagcccacg
atcgacgtgctcaacgcgctggaggtcgacgcgagcgcgatcggcaaccacgagttcgac
cagggccaggacgacctgaagaaccgcatcgagggccgcaccgacttcccggacctcgcc
gcgaacgtctacaacgcagacggaacgcgtctgatggagccgtacacggtcatcgacgac
ggtggcgtcaaggtggctgtcgtcggcgcggtcaccaccaagaccgtcggcaaggtcagc
cccgccgcgatcgagggcctggacttccgcgacccggtggacgaggtgaacaaggccatc
ggcgagctggaggccgacggcgtcgagtatgacatcctcgtcgcctcctaccacgagggc
gccagcgcgaacgccgagccgggcgtcgccccgaagaacaccgaccccatgttcgacaag
atcgtcgccgagaccgatcccgaggtcgatgcgatcttcaacggcgactcccaccgcgtc
tacaacttcaacgccgacgtccccggccaggacggcgaggtccggcccgtgatccagacc
ggctccagcgccgagaacctcggcgtggtctccctcgcgctcggcgaggacggcgactgg
gacgtcgtcggcgagccggagaaccggcccacggcccagggtgatgcgggctgcgcgatc
tccacccccgtgaccgagaaggtcgaccagatcgcgcaggacgcgatcgccgaggccgac
gtcatcggcgcccagcccgtcggctccgtcgccaccgacgtcaccacctcgtgggacgac
accaaggcctcgtacgtcgacggggtccgcaccgcggacgcccccatcggcaaccaggcc
accaccaagggcgacaaccgcacccgccactccgccgcgggcgacatgctcgccgactcc
atgaagtggtacctcgaggacgccggcctcgccggcgacgacgaggtcatcggcttcatg
aaccccggcggcatccgcgccgagctctggtacgacgccgccggcgccgagggcgacggc
gtggtcacctacgccgaggccaactccatggtccccttcggcaacacgctgaacgccggt
gaggtcaccggcgaccagttcatccagatgctcgaggagcagtggcagcgcaccgccgac
ggcggcgcggtcgacgagggcgacgagtccttcctggccttcagcgtctcgaacaacgtc
gagtacgtcttcgactccacccgcgagcgcgacgaccgcatcatcgacgtgcgcatcaac
ggcgagtcgatcgaccccgacgcgacctacacgatcgtcaccgcgagcttcctcttcgag
ggcggcgacaacatgtgggcgctctccgaggcgcacaacgtgcgcgactccggcgtgctg
gaccgcgatgccttcctccagtacctccagtccgaggacggccagaacctggagccgagc
tacgcgcagcgccagatcgacctgcagatcctcgacggcggcgagtacgactccgaggcc
ggcgtggaccgcgacccggtgctgcgcatcgggaacgtcgagtcccagagcctcggcgcc
ccggagatcgagaccgtccaggtcgacgccggcgagtacggcaccttcgaggcgccctac
acgctcgacgaggagaccggccggctctacgccgacgtcaccctcaccgactggatgtgc
gtccccgagggcacccaggtgccgctgacgatcaccgcggtccccgagaccggcaccgag
atcgtcaccgagatcggctccttcacctggaccgcgggcggcgcccccgacgagtgcgac
accgccacgcccccgccgggcgacgacgatgacgacgagccgaccacgcccccggccacc
gaggagcccaccaccccggcaccgggcgacggcgacgaccagggcgatggccagggcggc
gacgaccagggtcaggaccagggcggcgacgaccagggcgaggacgaggccggcggcccc
gccgtcatcgccgacgggaacggcgacgacgcggacgaccccgccgacgtcatccccgcc
gaggacaccacggcgggcggctcggaccgctccgacctggcccgcacgggcgtggaggtc
ggcccgatggtcgcggcgatcggcgtcatctcgctcgccggcgtcgcggcgctcggactg
cgccgtcgcatgacgcgccgctga

DBGET integrated database retrieval system