KEGG   Brachybacterium ginsengisoli: CFK41_02895Help
Entry
CFK41_02895       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ATG53846
UniProt: A0A291GUQ0
LinkDB All DBs
Position
complement(680896..681579)
Genome map
AA seq 227 aa AA seqDB search
MSRTIIIRCTTLAAATVLALTACGGTDDAPAEERDGGAAAEQEAPAGDSGDTDAEADDAA
ASDGGGEEEAGDGAAGSSEESAVVEIGTEFTDEETGDVITIVSAVRHNPTEYYLASDNPD
GEMIYLEVEVTAGDQFGGVISQQDFVLDDGGEEVNYASTADEELAAAGFENFEGASRRDG
GGAGYIPIYVEQTGDTLSGAYVRPEMKILGEDATVPEFRGEFEIPAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcacgatcatcatccgatgcaccaccctggccgccgcgaccgtgctcgccctg
accgcgtgcgggggcacggacgacgcccctgcagaggagcgggacgggggcgccgcagct
gagcaggaggcccctgcgggcgactcgggagacacggacgcggaggccgacgacgccgcg
gcgagcgacggcgggggcgaggaggaggccggcgacggcgcggccgggtcctccgaggag
tccgccgtggtcgagatcggcaccgagttcaccgatgaggagaccggcgacgtgatcacg
atcgtctccgcagtgcgccacaaccccaccgagtactacctggcctccgacaaccccgac
ggcgagatgatctacctcgaggtcgaggtgacggccggggatcagttcggcggcgtcatc
agccagcaggacttcgtgctcgacgacggcggcgaggaggtcaactacgcctcgaccgcg
gacgaggagctcgccgccgcgggcttcgagaacttcgagggcgcctcccgccgggacggc
ggcggcgccgggtacatcccgatctacgtcgagcagaccggtgacaccctcagcggcgcg
tacgtgcggcccgagatgaagatcctcggcgaggacgcgaccgtccccgagttccgcggc
gagttcgagatccccgccgcctga

DBGET integrated database retrieval system