KEGG   Brachybacterium ginsengisoli: CFK41_02990Help
Entry
CFK41_02990       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bgg  Brachybacterium ginsengisoli
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bgg01001]
    CFK41_02990
Enzymes [BR:bgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFK41_02990
Protein kinases [BR:bgg01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFK41_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 Kinase-like Haspin_kinase RIO1 BatA Kdo
Motif
Other DBs
NCBI-ProteinID: ATG53858
UniProt: A0A291GUJ0
LinkDB All DBs
Position
complement(697721..699946)
Genome map
AA seq 741 aa AA seqDB search
MSENSVVLGGRYRLGKILGTGGMAEVFLAEDTRLHRTVAVKVLRSDLARDASFQERFRRE
AHSAASLNHPSIVAVYDTGEEQQSTITGAEITIPYIVMEYVQGRTLREYIDPENPMPAAQ
AGEIMAALLSALEYSHRAGIVHRDIKPGNIMIDEAGAVKVMDFGIARAIADATSAMTATQ
AVMGTAQYLSPEQARGQLVDARSDIYSAACVMFEMLTGRPPFTGDTPVSIAYQHVREEPH
PPSAYNPAITPPLDAVILTGLTKDREQRYPSAVAFSRDIAAVVSGRAPNLAGGAVPAGDD
PEATTVLGPVGDATEALPAMGAAGGAAGAAGLAARSWGGLSATTPSTGPLALHPAEEVVV
EDDEKRRRPWWLIILVILAVLGLVAAALAITKPWDQGPEMVAIPAVSGDSQDDARAALRD
AGLEPTFVTAENPDVEAGSVIDTDPPEGTEVPVGSKVEVTVSGGAGATTVPDDLQGKSRE
EAQKALEDAGLTMTEGDTEDVPQEAGTVASTSPQGGANVEKGSPVEVRFASGNVEIPDVV
GTDIDKAKETLEARGFEVPEPSEREDDETEPGTVLSQTPTSDSGTVRFGSTVDLVVAAAP
GPVAVPNVTGRSLADAQKVLEDAGFGTTSKTESSESVSEGQVIQTDPPANEQVPRGSTIT
IIVSSGPKPTPTPTPTPTKTPTPTPTETPSPTEEPSDSPSPTETTEDPSTDQPSDEPGNG
EGNAQGKLGRGNDNGSGNGND
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagaacagcgtggtcctgggcgggagataccgcctggggaagatcctcggcacc
ggtggcatggcggaggtgttcctcgcggaggacacccgtctgcatcgcaccgtcgccgtc
aaggtgctgcgctcggacctcgcccgggacgccagcttccaggagcgcttccggcgcgag
gcgcacagcgccgcctccctgaaccatccctccatcgtcgccgtgtacgacaccggcgag
gagcagcagagcacgatcaccggggccgagatcacgatcccctacatcgtgatggagtac
gtccagggcaggactctgcgcgagtacatcgatccggagaacccgatgcccgccgcgcag
gccggcgagatcatggccgcgctgctgagcgccctggagtactcgcaccgcgccgggatc
gtgcaccgggacatcaagcccggcaacatcatgatcgacgaggccggcgccgtgaaggtg
atggacttcggcatcgcccgcgcgatcgccgacgccaccagcgcgatgaccgcgacccag
gccgtgatgggcaccgcccagtacctctccccggagcaggcccgcggccagctggtcgac
gcccgctccgacatctactccgcggcctgcgtgatgttcgagatgctcaccggtcgcccg
ccgttcaccggcgacaccccggtctccatcgcgtaccagcacgtgcgcgaggagccgcat
ccgccctcggcctacaacccggcgatcacccctcctctggacgcggtgatcctcaccggc
ctgaccaaggaccgcgagcagcgctacccgagcgcggtggccttctcccgcgacatcgcc
gccgtggtctccggccgggccccgaacctcgccggaggcgccgtccccgcaggcgacgat
cccgaggccaccacggtgctcgggccggtcggcgacgccaccgaggccctgcccgcgatg
ggcgcggcgggtggtgccgcgggtgccgcggggctggccgcacggagctggggcgggctc
tccgccaccacgcccagcacgggaccgctcgccctgcacccggccgaggaggtcgtggtg
gaggacgacgagaagcgtcgtcgaccctggtggctgatcatcctggtgatcctcgccgtg
ctgggcctcgtcgccgccgcgctcgcgatcaccaagccctgggaccagggccctgagatg
gtggcgatcccggccgtctccggcgactcccaggacgacgcccgggcggccctgcgcgac
gccggcctcgagccgaccttcgtcacggcggagaaccctgatgtcgaggcgggcagcgtc
atcgacaccgatccgcccgagggcaccgaggtcccggtcgggtcgaaggtcgaggtgacc
gtctccggcggagccggggccacgaccgttcccgacgacctccagggcaagtcccgcgag
gaggcccagaaggcgctcgaggacgccgggctgacgatgaccgagggcgacacggaggat
gtcccgcaggaggcgggcaccgtggcgagcacctcgccgcagggcggcgcgaacgtcgag
aagggctccccggtcgaggtgcgctttgcctccggcaacgtcgagatccccgatgtcgtc
ggcacggacatcgacaaggcgaaggagaccctcgaggcccgcggcttcgaggtccccgag
ccctccgagcgggaggacgacgagaccgagcccggcaccgtgctctcccagaccccgacg
tcggacagcggcacggtccgcttcggctccacggtggatctcgtggtcgccgcggccccg
ggcccggtcgccgtccccaacgtcacgggccgctcgctcgccgacgcccagaaggtgctc
gaggacgccggcttcggcaccacctcgaagacggagagctccgagtccgtgtccgaggga
caggtgatccagacggatccgcccgcgaacgagcaggttcctcgcggctccaccatcacc
atcatcgtgtcctccggcccgaagcccactccgacgccgacaccgacgccgaccaagacg
ccgacgccgacgccgaccgagacgccgtccccgaccgaggagccctcggactccccgtcg
ccgaccgagaccacggaggatccctccacggaccagccgagcgacgagcccggcaacggc
gagggcaacgcgcagggcaagctcggacgcgggaacgacaacgggagcggcaatgggaat
gactga

DBGET integrated database retrieval system