KEGG   Brachybacterium ginsengisoli: CFK41_02995Help
Entry
CFK41_02995       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bgg  Brachybacterium ginsengisoli
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bgg01001]
    CFK41_02995
Enzymes [BR:bgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFK41_02995
Protein kinases [BR:bgg01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFK41_02995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ATG53859
UniProt: A0A291GUH6
LinkDB All DBs
Position
complement(699943..701523)
Genome map
AA seq 526 aa AA seqDB search
MKTEPGLVLEGRYELTSLIATGGMGQVWKGLDQELEREVAIKVLREEYAGDEGFLKRFRA
EARHTAALSHDGIAALYDYGELDGRAYIVMELCPGRPLSDIIEENPGGLPEKRVVALLVE
LARALDAAHSKGVVHRDVKPENILVDQKNDWAMKITDFGIARSKDQARLTKTGLVMGTAQ
YLSPEQAMGKQATSLSDIYALGIVGYEMLVGKRPFTGSSQVEIAMAQVKQQPPALPEAIN
ADLRRLVMMMLAKAPANRPRSAAAVSRILEAVQRGVEPRFSTGAIPLTKVADHDWTGENR
VQPGADRRSDEGRGAAGSSPAERRPGASPTGTRTAAMPLPLSGRGRGIRHRSGASGPSAL
SAASAGSAPHRSARTARAASPGLSASSALSASSSLSASSADSARSASSPSSPPRDAGDSG
SGSGRRPAGIAAFDGVDTATSSRTVRGTSTTGRKVGGMSLPGLVLLLLVVVAIIAAVAGG
LGLLPLGAEGLPGVPEMAHVAAADTPSGTTMVGSVGVDHGMRTGVE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacagaaccaggactcgtgctcgaaggacgctacgagctgacctcgctgatcgcc
accggcgggatgggtcaggtctggaagggtctcgaccaggagctcgagcgcgaggtcgcg
atcaaggtgctgcgcgaggagtacgcgggcgacgagggcttcctcaagcgcttccgcgcc
gaggcgcgccacaccgcggccctctcccatgacgggatcgccgcgctctacgactacggc
gagctcgacggccgcgcgtacatcgtgatggagctctgcccgggccgtccgctctcggac
atcatcgaggagaaccccggcggcctgcccgagaagcgggtcgtcgcgctgctggtcgag
ctcgcccgcgcgctggacgccgctcactccaagggcgtcgtccaccgcgatgtgaagccc
gagaacatcctggtcgaccagaagaacgactgggccatgaagatcaccgacttcgggatc
gcgcgcagcaaggaccaggcacggctgaccaagaccggcctggtgatgggcaccgcccag
tacctctcccccgagcaggcgatgggcaagcaggccacctctctctcggatatctacgcg
ctgggcatcgtgggctacgagatgctggtgggcaagcgtcccttcaccggctcgagccag
gtggagatcgcgatggcccaggtcaagcagcagccgccggcgctgcccgaggcgatcaac
gccgatctgcgccgcctggtgatgatgatgctggccaaggcgccggcgaaccgcccgcgc
tccgccgcggccgtgtcgcggatcctcgaggcggtccagcggggcgtcgagccgcgcttc
agcaccggcgcgatcccgctgacgaaggtcgccgaccacgactggaccggggagaaccgg
gtccagcccggagcggatcgccgcagcgacgagggtcggggcgccgcgggatcctcgccc
gccgagcgtcggcccggagcctcgcccaccggcacccgcaccgccgccatgcctctgccg
ctgtccggccggggccgcgggatccgtcaccgctccggggcctccggcccctcagcgctc
tccgccgcctccgccgggtccgccccgcaccgctcggcgcggacggcgcgcgcggcgagc
cccggcctgtcggcgagctcggccctctccgcgagctcgagcctgtccgcgagctcggcg
gactccgcccgctcggcgtcctccccctcgtcgccgccgcgcgatgccggggacagcggg
agcggctcgggcaggcgcccggcagggatcgccgccttcgacggcgtcgacaccgcgacc
tcgtcgcggacggtgcgcggcacctccacgaccggtcgcaaggtgggcgggatgtcgctg
cccgggctggtgctgctcctgctggtggtcgtggcgatcatcgccgcggtcgcgggcggg
ctgggcctgctgccgctcggcgccgagggcctcccgggcgtgccggagatggctcacgtc
gcagcggctgacacgccgtcaggaactacgatggtcggatcggtcggggtcgaccatggc
atgaggacgggtgtggagtga

DBGET integrated database retrieval system