KEGG   Brachybacterium ginsengisoli: CFK41_03010Help
Entry
CFK41_03010       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein phosphatase
  KO
K20074  PPM family protein phosphatase [EC:3.1.3.16]
Organism
bgg  Brachybacterium ginsengisoli
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bgg01009]
    CFK41_03010
Enzymes [BR:bgg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CFK41_03010
Protein phosphatases and associated proteins [BR:bgg01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    CFK41_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C SpoIIE
Motif
Other DBs
NCBI-ProteinID: ATG53862
UniProt: A0A291GUM4
LinkDB All DBs
Position
complement(704350..705693)
Genome map
AA seq 447 aa AA seqDB search
MSIALRYAARSDVGLVRSNNQDSGYAGSHLLVVADGMGGHAGGDVASSVAIGHLAQLDSE
TPASDIVATLEESVLEANQEILRRARDEPQLRGLGTTITAMLRAEGKFALAHIGDSRAYL
LRDGEATQITKDHTFVQRLLDEGRLTEEEAERHPQRSVLMRVLGDVDADPELDLSLRPAH
PGDRWMLCSDGLSGLVSLDTIGAALTDFEDPGECAEELIQLALKGGGPDNITCIVADVID
LEELPRGVEAPSTTPQIVGSAARNRHAPTAASGPAAKAAALTREEPAVPYEDDDFSSEEP
PRRSPWPVLVVMMLLIALLGGVLWAGYAWSQRQFYVGTDGTNVVLYQGLSQDLGPISMSE
PVEVTDIALADLPEVTRQQVQSTITASDRSSADQIIDRLEQVSISNQPLPAPAPSDAGGA
SDSGGASDAGGASDGGGTPTPDEGEGT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgctctgcggtacgccgcccgctccgacgtcggcctcgtgcggtccaacaac
caggactccggctacgccggcagccacctgctggtggtcgccgacggcatgggcggccac
gccgggggcgacgtcgcctcctccgtggcgatcggccacctggcccagctggactccgag
acccccgcctccgacatcgtcgccaccctcgaggagagcgtgctcgaggcgaaccaggag
atcctgcgccgcgcccgcgacgagccgcagctgcggggactcggcaccaccatcaccgcg
atgctgcgggccgagggcaagttcgccctcgcccacatcggcgactcccgcgcctacctg
ctgcgggacggcgaggccacccagatcaccaaggaccacaccttcgtgcagcgcctgctg
gacgaggggcggctcaccgaggaggaggccgagcgccacccccagcggtcggtgttgatg
cgcgtgctcggcgacgtcgacgcggatccggagctggacctctcgctgcgccccgcgcat
cccggggaccgctggatgctgtgctccgacgggctctccggcctggtctccctggacacc
atcggtgctgccctgacggacttcgaggaccccggcgagtgcgccgaggagctgatccag
ctggccctcaagggcggcggaccggacaacatcacctgcatcgtcgcggacgtgatcgac
ctcgaggagctgccgcgcggcgtcgaggccccgtccaccaccccgcagatcgtcggctcc
gcggcccggaaccgccacgcccccacggccgcctccggccccgccgccaaggcggccgcg
ctcacccgggaggagcccgccgtcccctacgaggacgacgacttctcctcggaggagccc
cctcgacgcagcccctggccggtgctggtggtcatgatgctcctgatcgcgctgctcggc
ggtgtgctctgggccggatacgcctggtcgcagcgtcagttctacgtcggcaccgatggc
accaacgtggtgctctaccagggcctctcccaggacctgggaccgatctcgatgtccgag
ccggtcgaggtcaccgacatcgccctcgcggacctccccgaggtgacccgtcagcaggtc
cagagcaccatcacggcctccgaccggagctccgccgaccagatcatcgaccgcctcgaa
caggtctcgatctcgaaccagccgcttcccgcccccgccccgtcggacgccggcggcgcc
tccgactccggcggagcctcggacgcgggcggcgcctccgacggcggcggcacccccacc
cctgatgagggcgagggcacgtag

DBGET integrated database retrieval system