KEGG   Brachybacterium ginsengisoli: CFK41_03425Help
Entry
CFK41_03425       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3027
Motif
Other DBs
NCBI-ProteinID: ATG53931
UniProt: A0A291GUM9
LinkDB All DBs
Position
806146..807264
Genome map
AA seq 372 aa AA seqDB search
MTSPTTAPRRARTAKPKLDAIAAEAVELAREALLEVTEPGQVGEHLRAEASGERLVTHVF
ECTMPGYRGWSWVVVVTRASRAKVATVAETALLPGDDAILAPDWEPWSERLKPSDVGADD
LLPYREQDDRLEQGYEATGDEDADQVALWELGLGRTRVLSQEGRGEAAERWLEGDFGPRQ
TSGRGRRGTVAANCTSCGFFAQLSGSLRHEFGVCTNEWSPADGRVVHLNYGCGAHSETGQ
EDEDHEIPRGSGVVVDELDVELEKDAPADASPIEVTPAGEQPAGDAADAGEAGEAADAAE
ESPSTADQASDGQVEQVTAGRVADELPIDAVTPEEAAEQPAHEQVAAELPAADQPTEEAR
VDEVPEADSPED
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaccgaccaccgcaccccgccgcgcccgcaccgcgaagcccaagctcgacgcg
atcgcggctgaggccgtcgaactcgcccgcgaggccctgctcgaggtcaccgagcccggc
caggtcggcgagcacctccgcgccgaggcgagcggggaacggctggtcacccacgtcttc
gagtgcaccatgcccgggtaccggggatggtcctgggtggtcgtggtcacccgcgcctcg
cgcgccaaggtcgcgacggtcgccgagaccgcgctgctgcccggtgacgacgcgattctc
gcccccgactgggagccgtggtccgagcgcctgaagccctcggacgtcggcgccgacgac
ctgctgccctaccgcgagcaggacgaccgtctcgagcagggctatgaggccacgggcgac
gaggacgccgaccaggtcgctctgtgggagctgggcctggggcgcacccgcgtgctctcc
caggagggccgtggcgaggccgccgagcgctggctcgagggcgacttcggaccgcgtcag
acctccggccgcggtcgccgcggaaccgtcgcggcgaactgcaccagctgcggattcttc
gcccagctctccggctccctgcgccacgaattcggggtctgcaccaacgagtggtccccg
gcggacggccgtgtggtgcacctgaactacggctgcggtgcgcactccgagaccggccag
gaggacgaggaccacgagatcccgcgcggcagcggcgtggtcgtcgacgagctggacgtc
gagctggagaaggatgcacccgccgacgcgtcgccgatcgaggtgacccccgccggcgag
cagcccgcgggtgacgccgccgacgccggcgaggccggcgaggccgccgacgccgccgag
gagtcgccgagcacggcagaccaggcgtccgacggtcaggtcgagcaggtcacggcggga
cgggtcgccgacgagctgccgatcgacgcggtcacgcccgaggaggcggctgagcagccg
gcccacgagcaggtcgccgcggagctgcctgccgctgaccagcccacggaggaggctcgg
gtcgacgaggtccccgaggccgactcgcccgaggactga

DBGET integrated database retrieval system