KEGG   Brachybacterium ginsengisoli: CFK41_03750Help
Entry
CFK41_03750       CDS       T05099                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K18230  macrolide transport system ATP-binding/permease protein
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFK41_03750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgg02000]
    CFK41_03750
   01504 Antimicrobial resistance genes [BR:bgg01504]
    CFK41_03750
Transporters [BR:bgg02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Macrolide exporter
    CFK41_03750
Antimicrobial resistance genes [BR:bgg01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    CFK41_03750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_23 SMC_N AAA_16 AAA_22 NACHT AAA_28 ABC_tran_Xtn AAA_33 AAA_18 FtsK_SpoIIIE T2SSE NTPase_1 AAA_25 cobW Dynamin_N DAP3
Motif
Other DBs
NCBI-ProteinID: ATG53989
UniProt: A0A291GUV6
LinkDB All DBs
Position
876684..878402
Genome map
AA seq 572 aa AA seqDB search
MPAHPSLPLPATSVGVPSGPGDPSLHLWAEGISFSYPDRQVLTDVSLVVPAGRPTGLLGE
NGSGKSTLLRILAGQLPPEAGDSRVPGPVGVLHQELPFAATATLQDVLADALERARRLER
ELIAAGEALADPDPHSEQDDVSLGKEAVRRYDALLAEATLADVWNAERRAEEVLMGLGLG
AVDPATALGRISGGQRERLALAHLLIARPTSWLLDEPTNHLDDDGAAYLASAIAAHPGPV
LIASHDRAFLDDATLAQLDLDPAESPAAAEPGGLTAYTGGFSDYLEARFDARDRWEHRFR
TEQEELKVLRRAVEDSATVGHEGAAPRTEARASKKFYADRNATVVSRRLRESRARLAQLE
QDQVRKPPAELHLTHLPAAPGGSRGGVQLALSEVAVEGRLAPTSFSLSAGERLLITGANG
SGKSTLLETIAGRLGPTSGTVDRPRGLRIGHLGQDDQAIPGRTVGAHLRAAAGFAPGEED
AVPELFGLVHPRDLGRPLELLSRGQLRRVMLAAVLLDPPELLVLDEPTNHLALVTATRLE
AALAQWEGTVLIASHDRWLRSRWEGEVLEIGG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcacccctctctccccctgcccgccacctcggtgggcgtcccgtccggcccc
ggcgatccctcgctgcacctgtgggccgagggcatctccttctcctaccccgatcgccag
gtgctcaccgacgtgagcctcgtggtgcccgccggtcgacccaccggactgctcggcgag
aacggcagcggcaagtccacgctgctgcggatcctcgccggacagctgccgcccgaggcc
ggggactcacgggtccccggccccgtcggggtcctccaccaggagctccccttcgccgcc
accgcgaccctccaggacgtcctcgccgacgccctcgagcgcgcccgacgcctcgagcgc
gagctgatcgccgccggcgaggcgctcgccgatccggatcctcactccgagcaggacgac
gtatccctgggcaaggaggcggtgcgccgctacgacgcactgctcgccgaggcgacactc
gccgacgtgtggaacgccgagcgccgtgccgaggaggtcctcatgggcctgggcctcggc
gcggtggatcccgccacggcgctcggccggatcagcggcgggcagcgcgagcggctcgcc
ctcgcgcatctgctcatcgcccgccccaccagctggctgctggacgagcccaccaaccat
ctcgacgacgacggcgccgcctatctcgcctccgcgatcgccgcgcaccccggcccggtg
ctgatcgccagccacgaccgcgccttcctggacgacgccacgctcgcccagctcgacctc
gaccccgcggagtcgcccgcggccgccgagcccggcggcctcaccgcgtacaccggcggc
ttcagcgactacctcgaggcgcgcttcgacgcccgggaccgctgggagcaccggttccgc
accgagcaggaggagctgaaggtgctgcgccgggcggtcgaggactcggcgaccgtcggc
catgagggcgcggccccgcgcaccgaggcgcgggcctccaagaagttctacgcggaccgc
aatgccacggtggtctcgcgccgtctgcgcgagtcgcgggcccgcctggcccagctcgag
caggaccaggtgcgcaagccgccggcggagctgcacctgacgcacctgcccgctgcgccc
ggcgggagccgcggcggggtgcagctcgccctcagcgaggtcgcggtcgaaggccggctc
gccccgacctccttcagcctctccgccggtgagcgtctgctgatcaccggcgccaacggc
agcgggaagtcgaccctgctcgagaccatcgcgggccgtctggggcccacctcgggcacc
gtggaccggccccgcgggctgcggatcggccatctcggccaggacgaccaggcgataccc
ggccgcacggtcggagcgcacctgcgcgccgccgccgggttcgcgcccggcgaggaggac
gccgtgccggagctgttcggcctggtccatccgcgcgatctcgggcgccccctcgagctc
ctctcccgcggccagctgcgccgcgtgatgctcgccgcggtgctgctggacccgcccgag
ctgctcgtgctcgacgagcccaccaaccacctcgccctggtcaccgcgaccaggctggag
gccgcgctcgcgcagtgggaggggaccgtgctgatcgcctcacacgaccggtggctgcgc
agccgctgggagggcgaggtgctcgagatcgggggctga

DBGET integrated database retrieval system