KEGG   Brachybacterium ginsengisoli: CFK41_04365Help
Entry
CFK41_04365       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4229 Cytochrom_C_asm LapA_dom
Motif
Other DBs
NCBI-ProteinID: ATG54091
UniProt: A0A291GV31
LinkDB All DBs
Position
1006825..1007319
Genome map
AA seq 164 aa AA seqDB search
MRHFLLYAVLRLGLWALIWWLLTLMHVGVMLAGVLAALIAMLLSILFLDRFRSAAALRWK
AADERRAERRGPVHDEDADYEDSVLDAAEDPDSEDPDSEDSDSDPEIDPETDDAADDHAF
APADGSTDAGAGDAEGQDPSGPAALPELGRLDEGGHDSRGELRG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacttcctgctctacgccgtcctgcgactgggattgtgggccctgatctggtgg
ctgctcaccctcatgcacgtcggggtgatgctcgccggtgtcctggcggctctgatcgcg
atgctgctgtcgatcctgttcctggacaggttccgcagcgccgccgcgctccgctggaag
gccgccgacgagcgccgtgccgagcgccgcggtcctgtccacgacgaggacgcggactac
gaggactcggtgctggacgcggccgaggacccggactccgaggacccggactccgaggac
tcggacagcgaccccgagatcgatcccgagaccgacgatgcggccgacgaccacgccttc
gcgcccgctgacggctcgaccgatgccggcgcgggagatgccgagggccaggacccgtcg
ggtccggcggccctgccggagctcggccggctcgacgagggcgggcacgactcccgcggt
gagctcaggggctga

DBGET integrated database retrieval system