KEGG   Brachybacterium ginsengisoli: CFK41_05885Help
Entry
CFK41_05885       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: ATG54355
UniProt: A0A291GVV7
LinkDB All DBs
Position
1337036..1338712
Genome map
AA seq 558 aa AA seqDB search
MSSRPPSRPPRLAGYEYEQLLGSGGFADVFLYRQFRPQRRVAIKVLLSNVLDESVHRLFD
AEANVMAQMSTHPSIVTIHQAEVSDDHRPYIVMEYCPRPNYGLRFRKERITVAEALRVGV
QIAGAVETAHRAGILHRDIKPANILVTDYNRPALTDFGISIATGQGDDVEDSQGMSIPWS
PPEFFADTPQADVRSDVFSLAATVYSLLAGQTPFERRGQRNTASDLIHRISTEPLQPLSR
PDVPAELNRVLSIAMAKDRTGRFDTALAFGRSLQQVELSLSLPVTQMDVLDDRAVGTSHS
AEDDELDMHTRIRKVATVDPDSAGLTGPGTRRPLDPYAGVAPALGSPTGPGQRPRPGGPV
PSHGSADPASVESTMLRPAGAPLRAPSTAAPLQAADGGAPSSAQKAPTPAWPFVALAALL
VVVLGVGASLGVRHFVVTPEEGPATTEVNTVVTDSPEAPGEPTALDLQIISEGRGTEPGM
ARISWEPPEGVTQEAFYRVRWKDMPKNYEKYGVFQEVYGRNSVTLPIPPQLPGACVEVQT
VDPSGPVSASVEKCLDEK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgagaccgccctcacgaccgccccggctggccggctacgagtacgagcagctc
ctgggatccggcggcttcgccgatgtcttcctgtaccgccagttccgcccgcagcggcgc
gtggcgatcaaggtgctgctctcgaacgtgctcgacgagtcggtccatcggctcttcgac
gccgaggccaacgtcatggcgcagatgtcgacccacccgtcgatcgtcacgatccaccag
gcggaggtctccgacgaccaccgcccgtacatcgtcatggagtactgcccgcggcccaac
tacggtctgcgcttccgcaaggagcgcatcaccgtggccgaggcgctgcgggtgggtgtc
cagatcgccggcgccgtcgagaccgcgcaccgggccgggatcctccaccgcgacatcaag
cccgcgaacatcctcgtcacggactacaaccgcccggcgctgacggacttcggcatctcg
atcgccaccgggcagggcgacgacgtcgaggactcccaggggatgtcgatcccgtggtcc
ccgccggagttcttcgccgacacccctcaggccgacgtgcgctccgacgtgttctccctg
gcggcgaccgtgtactcgcttctggccgggcagacgcccttcgagcgtcggggtcagcgg
aacaccgcctcggacctcatccatcgcatctcgaccgaacctctccagcccctgagccgg
cccgacgtgccggcggagctgaaccgggtgctctcgatcgccatggcgaaggaccggacc
ggccggttcgacacggcgctcgccttcggtcgcagcctgcagcaggtggagctctcgctc
tccctgccggtcacgcagatggacgtgctcgacgaccgggccgtcggcacctcgcacagc
gccgaggacgacgagctcgacatgcacacacggatccggaaggtcgccacggtcgacccg
gactccgcaggcctcaccggccccggcacgcggcgaccgctcgatccctacgccggtgtc
gcgcccgcgctgggctcgccgacgggaccggggcagaggccccgcccaggcgggccggtc
ccgtcgcacggctccgcggatccggcctccgtcgagtccacgatgctgcgacccgccggg
gcaccgctgcgggcgccctcgacggcggcaccgctccaggcggccgacggcggcgcaccc
tcgtcggcccagaaggcgccgaccccggcctggcccttcgtcgccctggcggcgctgctc
gtggtggtgctcggggtgggtgcgagtctcggcgtgcgccacttcgtggtgaccccggag
gagggccctgcgaccacggaggtcaacacggtggtgacggattccccggaggctcctggg
gagccgacggccctcgatctgcagatcatctccgaggggcggggcacggagcccgggatg
gcgaggatctcctgggagccgccggagggggtcacccaggaggccttctaccgggtgcgg
tggaaggacatgccgaagaactatgagaagtacggcgtgttccaggaggtctacggccgc
aactccgtgaccctgccgatcccgccccagctccccggagcgtgcgtcgaggtgcagacg
gtggatccttcaggtccggtcagcgcctcggtcgagaagtgtctggacgagaagtga

DBGET integrated database retrieval system