KEGG   Brachybacterium ginsengisoli: CFK41_06575Help
Entry
CFK41_06575       CDS       T05099                                 

Definition
(GenBank) dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase AAA_29 AAA_22 SMC_N oligo_HPY AAA_30 AAA_25 AAA_5 Mg_chelatase AAA_18 AAA_33 NACHT DUF87 ATPase eIF-5_eIF-2B
Motif
Other DBs
NCBI-ProteinID: ATG54469
UniProt: A0A291GW91
LinkDB All DBs
Position
1493392..1494276
Genome map
AA seq 294 aa AA seqDB search
MTTTDTTHGIEGSGSSGSSDGDDSGRVVLEGRHLVKEYPAGTRRGLLRRQETMRAVDDVS
LRLVQGRVTALVGQSGSGKSTLGRMLARLIPTTSGEILLEGRAVPASTSSGHREYVGDVQ
LTLQDPFASLNPLRRIAYTLGRAVRIHQSARGTEEVHARCLELLERVGLTPAERYLDRFP
HELSGGERQRVSFARALAASPKVLIADEPVSMLDVTIRKEMLDLIDALRRDEDLAVLYIT
HDLGSARRYSDEVMVMHQGRVVESGESRSVIDDPQEEYTRRLLAAAPDPASRLR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccgacaccacccacggcatcgagggctccggcagctcgggcagctccgac
ggtgacgactcgggacgcgtggtccttgagggacgccatctggtcaaggagtatcccgcc
ggcacccgccgcggtctgctgcgacgtcaggagacgatgcgggccgtcgacgacgtctcg
ctccggctcgtccagggccgggtcaccgccctggtggggcagagcggctcggggaagtcg
accctgggaaggatgctggcccggctcatccccaccacctccggcgagatcctgctcgag
gggcgcgcggtgccggcctcgaccagctccggccaccgcgagtacgtgggcgacgtgcag
ctcacgctgcaggaccccttcgcctcgctgaacccgctgcgccgcatcgcgtacacgctg
ggccgggcggtgcggatccaccagagcgcgcgcggcaccgaggaggtgcacgcgcgctgc
ctcgagctgctcgagcgggtgggcctcaccccggcggagcgctacctggaccgcttcccc
cacgagctctccggcggggagcgccagcgcgtctccttcgcgcgggcgctcgcggcctcg
ccgaaggtgctgatcgcggacgagcccgtctcgatgctcgacgtcaccatccgcaaggag
atgctcgacctgatcgacgccctgcgacgcgatgaggatctcgcggtcctctacatcacc
cacgacctgggcagcgcacggcgctactcggacgaggtgatggtgatgcaccagggccgg
gtggtggagtccggagagagccgctcggtgatcgacgacccgcaggaagagtacacccgg
cgtctcctcgccgcggcaccggatccggcgtcccgcctgcggtga

DBGET integrated database retrieval system