KEGG   Brachybacterium ginsengisoli: CFK41_08465Help
Entry
CFK41_08465       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ATG56549
UniProt: A0A291H256
LinkDB All DBs
Position
1902427..1902960
Genome map
AA seq 177 aa AA seqDB search
MVLRGAASALAAAALLVGATACTDDEGDEPSETGTAQEADPSDSGSTDPEESGTASDGGG
DSPFSRDELDAASARFVDILQVLDDGDWEAACGMVLDPTTGAAPEGDRLQECVDGVESEL
GGRSDLVDPGAFDSMDASMVEAEDTGDGTVALSVLGNDLDIPMAPGDDGRWYLVIPF
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgcgaggtgccgcttccgccctggcggccgcagcgctgctggtcggcgcgacg
gcctgcaccgacgacgagggggacgagccgtcggagaccggcaccgcgcaggaggccgat
ccgtcggacagcgggagcaccgacccggaggagagcggcacggcgagcgacggcggcggc
gacagccccttcagccgcgacgagctcgatgcggcctccgctcgattcgtggacatcctc
caggtgctcgacgacggtgactgggaggccgcctgcggcatggtcctggaccccaccacc
ggagccgccccggagggtgatcggctccaggagtgcgtggacggcgtggagtccgagctc
ggaggacgctccgacctcgtcgatcccggcgccttcgactcgatggacgcctcgatggtc
gaggccgaggacaccggggacggaaccgtcgccctcagcgtgctcggcaacgacctggac
atcccgatggcacccggcgacgacggccggtggtacctcgtcatcccgttctga

DBGET integrated database retrieval system