KEGG   Brachybacterium ginsengisoli: CFK41_09415Help
Entry
CFK41_09415       CDS       T05099                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CFK41_09415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bgg03400]
    CFK41_09415
Enzymes [BR:bgg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CFK41_09415
DNA repair and recombination proteins [BR:bgg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CFK41_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ATG54958
UniProt: A0A291GXR2
LinkDB All DBs
Position
complement(2111385..2113958)
Genome map
AA seq 857 aa AA seqDB search
MATDEQSVRIEDRTLKVSNLEKVFFSSTGTTKGEVLDYYRRIAAVMIPQARRRPATRKRW
VDGVGTADRPGTVFFRKDLEDRAPSWVPRADLEHSDGVSTYPLVDETAVLVWLAQLAALE
IHTPQWRFDEDLTASNPDRLVLDLDPGPGADLTDCARVALWCREILEDMAMESFPVTSGS
KGIHLYAPLDGAATAQQITQVAHELARALEEDHPDLVVSDMKKSLRSGRVLVDWSQNNGH
KTTVCPYSLRGRLRPSVAAPRTWEEIEDPELDQLELGDVLRRVEDGMDPIAALGSSAGKG
GTEGGASSGGRSRDRLEVYRSRREASRTPEPVPEGRPDPEGARDPREPEDPMFVIQEHHA
SRLHWDFRLEHDGVLVSWAVPKGPPVDVDVNRLAVQTEDHPLEYGTFEGTIPKGEYGAGD
VTLWDTGSLEVETWRDGEEIVVVCHGRPDGGLGGAPRRFAFVHTGGMGGNGDPTSGRADA
SWLLHLTKDQPPTGEEPASCEGRGRPREERAPSASSPTSASSSGARPEPAAMSDPISPML
ATLGSRDDIRDQDDWAFEMKWDGVRVVATVTAEAVRLTSRGGKDLTSTFPELAELLEALD
PAALAAGETVLDGEIVALDARDRPSFSRLQRRLGLTRDRDVERARKEVEAHVMIFDLLRR
GGVPLLRTPYRERRSALFDTVRSTEHIHVPQADHGDVDHAIELSKELQLEGVMAKTETGV
YQPGRRSRTWIKIKNARHQEVVVIGWRHGKGGRSGSIGSLLLAIPDGEGVLRYVGRVGTG
FSDRDLEQITSTLASRARRTPPADDVPAADRRDAEWVRADLVGEVRYSERTEDGRLRHPV
WRGWRRDKQAHEVRGEQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgatgagcagagcgtcaggatcgaggaccgcacgctgaaggtgtcgaacctc
gagaaggtcttcttctcctccacggggaccaccaagggagaggtgctggactactaccga
cgcatcgccgcggtgatgatcccgcaggcgaggcggcgcccggcgacccgcaagcggtgg
gtcgacggggtggggaccgccgatcggcccggcacggtcttctttcgcaaggatctcgag
gatcgcgccccgtcgtgggtgccgcgtgcggacctcgagcacagcgacggcgtctccacc
tatccgctggtcgacgagaccgccgtgctggtgtggctcgcgcagctggcggcgctcgag
atccacacgccccagtggcgattcgacgaggatctgacggcgtcgaaccccgaccgcctc
gtgctggacctcgaccctgggccgggagccgacctcacggactgcgcccgcgtcgccctg
tggtgccgcgagatcctggaggacatggcgatggagtccttcccggtcacctccggctcc
aagggcatccacctctacgcgccgctggacggcgccgccaccgctcagcagatcacccag
gtcgcccacgaactggcgagggcgttggaggaggatcatcctgatctcgtggtcagcgac
atgaagaagtcattgcggtcgggcagggtgctcgtggactggtcgcagaacaacgggcac
aagaccacggtgtgcccctactcgctgagaggacggctgcgcccatcggtggcggcgccc
cgcacgtgggaggagatcgaggaccccgagctcgatcagctcgagctcggcgacgtcctg
cgtcgggtcgaggacggcatggacccgatcgcggcgctgggctcgagcgccgggaagggc
gggacggagggcggcgcctcgtcgggcgggcggtcgagggaccgcctggaggtctaccgc
tccaggcgggaggcgtcgaggacacccgagcccgtcccggagggacggccggatccggag
ggggcacgtgaccctcgcgagccggaggacccgatgttcgtgatccaggagcaccacgcg
tcccgactgcactgggacttccgtctcgagcacgacggggtgctggtctcctgggctgtg
cccaagggccccccggtcgacgtcgacgtgaaccgccttgcggtgcagaccgaggaccac
ccgctcgagtacgggaccttcgagggcacgatcccgaagggcgagtacggcgccggcgac
gtcaccctctgggacaccgggtccctggaggtcgagacgtggcgcgatggagaggagatc
gtcgtcgtctgccacggtcgcccggacggtggcctcggcggcgcgccacgccgtttcgcc
ttcgtccacaccggcggcatgggcgggaacggtgatcccacgtcggggagggccgatgcc
agctggctgctgcacctcacgaaggaccagccgccgacgggggaggagccggcgtcgtgc
gaggggcgggggaggcctcgggaagagcgcgctccttcggcgtcttcccccacctcggcg
tcgtcctcgggggcccggcccgagccggccgccatgagcgatccgatctcgccgatgctc
gccactctcgggagccgggacgacatccgtgaccaggacgactgggccttcgagatgaag
tgggacggggtgcgtgtcgtcgccacggtcacggcggaggcagtccgcctgaccagccgc
ggtggaaaggacctcacctccaccttccccgagctcgccgagctgttggaggcgctcgat
cccgcggccctcgctgcgggggagaccgtcctcgacggtgagatcgtcgcactcgacgcc
cgcgaccgcccctccttctcccgactgcagcgacgactcggtctcacgcgagaccgcgat
gtggaacgggccaggaaggaggtcgaggcgcatgtgatgatcttcgacctgctccggcgc
ggaggcgttccgctgcttcgcaccccgtaccgcgagcgccgatccgcgctgttcgacacg
gtgcggtcgaccgagcacatccacgtgccgcaggcggaccacggcgacgtcgaccacgcc
atcgagctctcgaaggagctccagctcgaaggcgtcatggcgaagaccgagacgggtgtc
taccagcccggcaggcgcagtcgcacctggatcaagatcaagaacgcccgccaccaggag
gtcgtggtcatcggctggcgacacgggaagggcggtcgctccgggagcatcgggtccctg
ctgctggcgatccccgacggggagggtgtcctgcgctacgtcggtcgtgtcgggacggga
ttcagcgaccgggatctcgagcagatcacgagcacgctcgcctcccgtgcccgcaggacg
ccaccggcggacgacgtgcccgctgcggatcgccgcgatgcggagtgggtgcgtgcggac
ctcgtcggggaggtccggtacagcgagcgcaccgaggacggccgcctgcggcatcctgtg
tggcggggatggaggcgtgacaagcaggcgcacgaggtacgaggagagcagtga

DBGET integrated database retrieval system