KEGG   Brachybacterium ginsengisoli: CFK41_09795Help
Entry
CFK41_09795       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bgg  Brachybacterium ginsengisoli
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bgg01001]
    CFK41_09795
Enzymes [BR:bgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFK41_09795
Protein kinases [BR:bgg01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFK41_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like ABC1 RIO1 Haspin_kinase Kdo FTA2
Motif
Other DBs
NCBI-ProteinID: ATG56569
UniProt: A0A291H280
LinkDB All DBs
Position
2199156..2201270
Genome map
AA seq 704 aa AA seqDB search
MSAATSTSPGISQLLDGRYRVEEPIARGGMATVHRGHDERLDRVVALKIMHPHLAMDEDF
RRRFGREARAAARLAHRNVVGVFDQGEDEDRIYLAMELVEGETLRARLVAQERLTLRDSL
DVTTQVLQALVAAHEAGIVHRDIKPENILLSHEDLVKVADFGLARATGSNNSSASAALLG
TVAYISPEVVTRGHSDERSDLYSLGIVLFEMLTGLQPFRGEQPVHIAFQHVHEDIPAPSS
LVSGIPRELDSLVTWAAAREVEQRPATAKDLLRAVRELAATLPTAVLDSRPHGREDADTS
DVPRVTTSLEEVASALDHSPRAFPAELLAPGEDLEDPSSHDADEEELAQTADDEPSTPDS
ADTDEDGSGEDGGGEDGGGEDEGGRRLLVMRSPRARRGRHLPAGTRRPSRIMAALAALCL
VAGLTAGAWAGGDWYFNTGPGADRTIPLVTGTPLADAEAALTSSGLTVTTDERFDATVPA
GHVISADPSTGTTVKKGSAVTVVVSKGEETFPVPELAGLELDSARTEVEDLGLELVEDDP
EYSETVPEGQVISQSASADALPAGGEVHVVVSQGRQPIAVPDQTGRGGSSARSALEGAGF
RVTSAQAHSSSVPRGAVISQSPASGSLFRGDTVHLVTSLGPEMVEVPDVFRSPEAEAKSA
LEGAGFTVQVVHDKGDPVFGLVYEQSAAAGSELEKGSTVTIKVF
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggcgacgtcgacttcccccggcatcagccagctcctcgacggtcggtaccgg
gtcgaggagccgatcgcgcgcggcggaatggcgacggtgcaccgcggccacgacgagcgg
ctggaccgcgtggtggcgctgaagatcatgcacccccacctcgcgatggacgaggacttc
cgccgacgcttcggccgggaggcccgggccgcggcacggctcgcgcaccgcaacgtcgtg
ggcgtgttcgaccagggcgaggacgaggaccgcatctatctcgcgatggagctcgtcgag
ggcgagaccctgcgagcccgcctcgtcgcccaggagcgcctcaccctccgcgacagcctc
gacgtgaccacgcaggtgctgcaggccctcgtcgccgcccatgaggccggcatcgtccac
cgggacatcaagcccgagaacatcctgctgagccatgaggacctggtgaaggtcgcggac
ttcggcctggcccgcgccaccggctcgaacaactcctcggccagcgcagcgctgctgggg
accgtcgcctacatcagcccggaggtggtcacgcgcggccactccgatgagcgcagcgac
ctctactccctcgggatcgtcctcttcgagatgctcaccgggctgcagccgttccggggc
gaacagcccgtgcacatcgccttccagcacgtgcacgaggacatccccgccccctcctcg
ctcgtctccggcatcccgcgcgagctcgactccctggtcacctgggccgccgcgcgcgag
gtcgagcagcgtcctgccaccgcgaaggatctgctgcgcgcggtccgggagctcgccgcg
acgctgcccaccgccgtcctggactcgcggccccacgggcgcgaggacgcagacacctcg
gacgtcccccgggtcacgacctccctcgaggaggtcgcctcggcgctcgatcacagcccc
cgggcgttccccgccgagctgctcgccccgggcgaggacctcgaggacccgtcctcgcac
gatgccgacgaggaggagctcgcgcagacggccgacgacgagccgagcacccctgattcc
gccgacaccgacgaggacggcagcggagaggacggcggcggagaggacggcggcggagag
gacgagggcggccgacgactcctggtgatgcgctcgccgcgggctcgacggggtcgccat
ctccccgccggcacccgtcggccctcgcgcatcatggcggcgctcgccgcgctgtgcctg
gtcgccggtctcaccgccggtgcctgggcgggcggggactggtacttcaacaccgggccc
ggcgccgaccggaccatccccctggtgacggggacgccgctcgcggatgccgaggccgcg
ctcacctcctcggggctgaccgtcaccaccgacgagcgcttcgacgccacggtccccgcc
gggcacgtcatctccgccgatccctcgacgggaaccaccgtcaagaagggcagcgccgtc
acggtcgtcgtgtccaagggcgaggagaccttcccggtccccgagctggcaggactcgag
ctcgacagcgccaggacggaggtcgaggatctgggcctggagctcgtcgaggacgatccc
gagtactccgagaccgtgcccgagggccaggtcatctcccagtccgcgagcgcggatgcg
ctgcccgccggcggcgaggtccacgtggtcgtctcccagggccgccagccgatcgccgtg
cccgatcagaccgggcgcggcggcagctccgcacgctcggccctcgagggggccgggttc
cgggtcaccagcgcccaggcgcactcgagcagcgtcccccgcggtgcggtgatctcgcag
tcccccgcctccggctccctcttccgaggcgacacggtccacctcgtgacctcgctcggt
ccggagatggtggaggtcccggacgtcttccgctcccccgaggccgaggcgaagtcggcc
ctcgagggcgccggcttcacggtgcaggtcgtccacgacaagggcgatccggtgttcggc
ctggtctatgagcagtccgccgccgcgggctccgagctggagaagggctcgacggtcacg
atcaaggtgttctga

DBGET integrated database retrieval system