KEGG   Brachybacterium ginsengisoli: CFK41_10980Help
Entry
CFK41_10980       CDS       T05099                                 

Definition
(GenBank) nucleoside-diphosphate sugar epimerase
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Epimerase NmrA RmlD_sub_bind TrkA_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ATG55225
UniProt: A0A291GYE7
LinkDB All DBs
Position
2456805..2457791
Genome map
AA seq 328 aa AA seqDB search
MHHLVIGEGQIGRALIERARADGDRVTILRRSEVAPSPGIDRVAGDVLDPTALAAALTGV
DAVHAVFHAAYDARIWRRDLPPRELAVLDAAVERGIPALFPESMYGFQGEARNLVEGAGP
TPLDAKGEARIALLEQRRRHAAQTISLVASDLVGPTAVGTGAAVASAMIIERIAAGRRPV
VVAAADAPHTLTHLPDLAAAMLHAARHAERLAPSGDAVLHAPSAPARSQRELAALASSLL
GQPDRRPLRIPILALRALSGVNTFARELSGISRIWSEPCVLQPGILTTQEGLEPTPWSQA
VRSTVEQAEAARTGTRTTETSSSAPRLR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatctcgtcatcggtgaaggtcagatcggccgtgcgctcatcgagcgcgctcgg
gcggacggcgaccgcgtcaccatcctgcggcgcagcgaggtcgccccctccccgggcatc
gaccgcgtcgccggcgacgtgctcgacccgaccgcgctcgccgcggccctgaccggggtc
gacgcggtccacgccgtcttccatgccgcctacgacgcacgcatctggcgacgcgacctg
ccgcctcgcgagctcgccgtgctcgacgcggccgtcgagcgcgggatcccggccctcttc
ccggagtcgatgtacggcttccagggcgaggcccggaacctggtcgagggcgccggaccg
acgccgctggacgcgaagggcgaggcgcgcatcgccctgctcgagcagcgccgccgccac
gccgcgcaaacgatcagcctggtcgcctcggacctcgtgggcccgacggccgtgggcacc
ggcgccgcggtcgcctcggcgatgatcatcgaacgcatcgccgcggggcggcgccctgtc
gtggtcgccgctgcggacgccccgcacacgctcacccatctccccgacctcgccgccgcc
atgctccatgcggcccggcacgccgagcgcctcgccccgagcggggacgcggtgctgcat
gccccgtcggcccctgcccgctcgcagcgcgagctggccgccctcgcctcgtcgctcctg
ggacagccggaccgtcggccgctgcggatcccgatcctcgccctgcgcgcgctgtccggc
gtgaacaccttcgcccgggagctgtccggcatctcgcggatctggtcggagccctgcgtc
ctgcagccgggcatcctcaccactcaggaggggctggagcccacgccctggtcccaggcc
gtgcgctccaccgtggagcaggccgaggcggcgcggaccggcacccgcacgaccgagacc
tcctcgagcgccccgcgcctccgatga

DBGET integrated database retrieval system