KEGG   Brachybacterium ginsengisoli: CFK41_11105Help
Entry
CFK41_11105       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo APH RIO1
Motif
Other DBs
NCBI-ProteinID: ATG56592
UniProt: A0A291H2F8
LinkDB All DBs
Position
2483611..2484759
Genome map
AA seq 382 aa AA seqDB search
MSDVIAGRIALIEPLARGASGSLWRAVDRRYDAVCAAKVMRQRDGADVLRFVREQTVGTA
QGLGQHPHLLPPYTWVAEDDTIVLVMPLVHGGTLADALAEQGALSPSLVAELLRQLLDAL
SAMHEAHWVHRDLKPANLLLEATGDAAPHLLLADFGIALHEDDVRLTETGFAHGTPGFMA
PEVLEGLGTSAAQDVWAAAACALDALAPQRPRERLAPSELPERLRQALRTSPDPSAGPLE
ALLQSMLLRDPASRPTAAQARDRIPRPWAPTAQWARTAGGAPFTVPDRVEASDGRREVPL
DGPGALAGLAPGLHERLTARSRSATTPVPPAASAEPSDSPSTTERLAEVPPHRAAITTGV
VLLAVSALSFAGAAGLLWSALS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgtcatcgccggtcgcatcgcgctgatcgaacccctcgcccgcggcgcctcc
gggtccctgtggcgcgccgtggaccgccgctacgacgcggtgtgcgcggcgaaggtgatg
cgacagcgcgacggcgccgacgtgcttcgcttcgtgcgcgagcagacggtcgggaccgcg
cagggactcggacagcacccgcacctgctgccgccgtacacctgggtcgccgaggacgac
acgatcgtgctggtgatgccgctggtgcatggcgggaccctggccgacgccctcgccgag
cagggcgcgctctcgccgtccctcgtcgccgagctgctgcgacagctgctcgacgcgctc
tcggcgatgcacgaggcgcactgggtgcatcgggatctcaagcccgcgaacctcctgctg
gaggcgaccggtgacgccgcgccgcacctgctcctggccgacttcgggatcgcgctgcac
gaggacgacgtgcgtctgaccgagaccggtttcgcccatggcaccccgggcttcatggcg
ccggaggtcctcgagggcctgggcacctccgccgcccaggacgtgtgggccgccgcggcc
tgtgcgctcgacgcgctcgctccgcagcggccccgggagcggctcgccccgtcggagctc
ccggagaggctgaggcaggcgctcaggacgagccccgatccgtcggccggcccgctcgag
gcgctgctgcagagcatgctcctgcgggatccggcctcacgccccacggcggcgcaggcg
cgggaccgcatcccccgtccctgggcgccgacggcgcagtgggcccggaccgcgggcggg
gcaccgttcacggtccccgaccgggtcgaggcctccgacggccgacgggaggtgccgctg
gacggcccaggtgccctcgccgggctcgccccgggcctgcacgagcggctcacggcccgg
tcccggtcggcgaccacccccgtcccgcccgccgcgagcgccgagccctccgactccccg
agcaccaccgagcgcctcgccgaggtcccgcctcaccgggcggcgatcacgaccggcgtg
gtgctcctggcggtctccgcgctgagcttcgccggggcggccgggctgctgtggtcggcg
ctcagctga

DBGET integrated database retrieval system