KEGG   Brachybacterium ginsengisoli: CFK41_11190Help
Entry
CFK41_11190       CDS       T05099                                 

Definition
(GenBank) hypothetical protein
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zincin_2
Motif
Other DBs
NCBI-ProteinID: ATG55264
UniProt: A0A291GYU3
LinkDB All DBs
Position
2506284..2507903
Genome map
AA seq 539 aa AA seqDB search
MSDAPIPGGPGDMDEEALKRFLKETFGDALPEGALDGLDLSALAQQANLPQDPAQLRAAA
AQMQSMFAAQGDSPVNWDMAEDIARRTAAGQTGIPGMPEPTGTPGDPGPSDSSVSELRQA
AQVARLWLDPVISIDVPSTELGVYSRGTWLHRTLPHWKPIVEPVAKYMAGAIGEAIAAQL
GEMGDLGGAGMGMPGGDPAAMMERIGGTMFGVQFGHAIGALAREAAGTTDLGLPLGRDGE
PALVASNVEDLIAAHSLDPGAARIFLAAREIAHTALFTSAPWLGRALFSAIEDYSRGITL
DLDALDEMVRGLDLADPEAMQARRPEEMFVFTRRASQERALEELATTLALIEAWVDHVTT
KALDGKLPDLEAMREVLRRRRAAGGPAEEMLSKTVGIELRPRRVREALSWWESVLDTEGE
SGREAKWDHPDLLPTAEVLSGRPQAPRPEAAPTEAEELAGVALPEDFDAELEKLLSGDGQ
DRAPREDEQGGLRGSASSARDETEADATGEDGSGEDGTGEDGTGEDGEGGRSSAGDDER
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccccgatcccgggtggacccggtgacatggacgaggaggcgctgaagcgc
ttcctcaaggagaccttcggggacgcgctccccgagggagccctggacggactggacctg
tcggcgctggcgcagcaggcgaacctgccgcaggaccccgcccagctgcgcgcggccgcg
gcgcagatgcagagcatgttcgccgcgcagggcgacagcccggtgaactgggacatggcc
gaggacatcgcgcgccgcaccgcggcgggccagaccggcatccccggcatgcccgagccc
accggcacccccggcgaccccggcccgagcgactcctcggtctccgagctgcgccaggcc
gcccaggtggcgcggctgtggctggatcccgtgatctcgatcgacgtgccctccaccgag
ctcggcgtgtacagccgcggcacctggctgcaccgcaccctgccccactggaagccgatc
gtcgagccggtcgccaaatacatggccggcgcgatcggcgaggcgatcgccgcgcagctg
ggtgagatgggcgacctcggcggggccggcatgggaatgcccggaggcgaccccgcggcg
atgatggagcgcatcggcgggaccatgttcggcgtgcagttcggccacgccatcggcgcc
ctcgcccgggaggcggcgggcaccaccgatctcggcctcccgctgggccgggacggcgag
ccggccctggtcgcctcgaacgtcgaggacctgatcgcggcgcactcgctcgacccgggc
gccgcccgcatcttcctggcggcccgcgagatcgcccacacggccctgttcacctccgcc
ccgtggctggggcgggctctgttctccgcgatcgaggactactcgcgcggtatcaccctg
gacctcgacgcgctcgacgagatggtgcgcgggctcgatctcgccgatccggaggccatg
caggccaggcgtcccgaggagatgttcgtgttcacgcggcgcgcatcgcaggagcgcgcc
ctcgaggagctggccaccaccctcgccctcatcgaggcgtgggtggatcacgtgaccacc
aaggcgctcgacggcaagctgccggatctcgaggcgatgcgcgaggtgctgcggcgccgc
cgcgccgcgggcgggcccgccgaggagatgctctcgaagaccgtgggcatcgagctgcgc
ccgcgccgggtccgcgaggcgctgtcctggtgggagagcgtcctggacaccgagggcgag
agcggccgcgaggcgaagtgggaccacccggacctgctgcccaccgcggaggtcctctcc
ggtcggccgcaggccccgcggcccgaggcggccccgaccgaggccgaggagctcgccggg
gtggcccttcccgaggacttcgacgccgagctggagaagctgctctccggcgacggccag
gaccgtgcccctcgcgaggacgagcagggcggcctgcgcggctccgcttcgagcgcgcgg
gacgagaccgaggccgacgcgacgggcgaggacggctcgggcgaggatggcacgggcgag
gacggcacgggcgaggacggcgagggcggtcgctcctccgcgggcgacgatgagcgctga

DBGET integrated database retrieval system