KEGG   Brachybacterium ginsengisoli: CFK41_11250Help
Entry
CFK41_11250       CDS       T05099                                 

Definition
(GenBank) phosphohydrolase
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ATG56594
UniProt: A0A291H2K8
LinkDB All DBs
Position
2522654..2524369
Genome map
AA seq 571 aa AA seqDB search
MPEAPEASAAQAAVPHRGLRRRRQGRQRLLHVATTTVVAVLGAIVGLLLVPDTTVEVGPL
TASVHLRPSLSSETVLLLPPVGQVAFDSHTAPVRIEARIKGVDVEKAEALFYADSGFAEL
QSSAPETIAAAAAKNAALNALFAALGAGLAVGLTFRRVRRALVAGGGAVAVVGASVAATS
ATFSAESLSQPRFEGLLSQAAYIADLGQGKAIDYQSYRATLAEFVGQVSALYIAADSLPV
GLDQENLITVLHVSDIHDNPQAYDVIDQLHTQFAIDAVIDTGDIISWGTPVENELLHRIG
TLDVPYVYISGNHDGAAAAATIEDQPNATVVDNEVVEVAGLRIAGIGDPRFAADDDSDAG
GWREGDEAVDASVFQLGDTIQAYDATHPEEPVDIALVHDPTQPEGLLGRTPLVMSGHMHT
SKVELDREGSGTDWLTVGSTGGALASGGVQPVLRGEAPLDLTARMLYFDKETRRLVAYDD
IVMGGLGLVSVSIARTQMPEEAPVLEIPDSAETPEGTIPPEQEVAPGEGLPDEDRVTPTD
PVSPPPETDGPAPSDSGGGAGGGGGSDGGGG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaggcaccggaggcctctgccgcgcaggcggccgtcccgcatcgagggctccgt
cgccgtcggcagggccgccagcggctgctgcacgtcgccaccaccacggtcgtggcggtg
ctcggcgcgatcgtcggcctgctgctggtccccgacacgaccgtcgaggtcggcccgttg
acggcgagcgtccacctgcgcccctccctctcctccgagacggtgctcctgctcccgccc
gtgggccaggtcgccttcgactcgcacaccgcgccggtgcgcatcgaggcgcgcatcaag
ggcgtcgacgtcgagaaggccgaggccctgttctacgcggactccggcttcgccgagctg
cagagctccgccccggagaccatcgccgccgccgcggcgaagaacgcggcgctgaacgcc
ctgttcgccgccctcggggccggtctcgccgtggggctcaccttccgtcgggtccgtcgc
gccctggtcgcaggaggcggcgccgtcgccgtcgtaggagcgtcggtggccgcgacctcc
gcgaccttctccgccgagtcgctgagccagccgaggttcgaggggctgctctcccaggcg
gcgtacatcgcggatctcggccagggcaaggccatcgactaccagagctaccgcgccacc
ctcgcggagttcgtcggccaggtctccgcgctgtacatcgccgcggactccctcccggtg
ggcctggaccaggagaacctgatcaccgtcctgcacgtctcggacatccatgacaacccg
caggcctacgacgtcatcgatcagctgcacacccagttcgcgatcgacgcggtcatcgac
accggcgacatcatctcctggggcaccccggtggagaacgagctgctgcaccgcatcggc
accctcgacgtgccctacgtctacatcagcggcaaccatgacggcgccgcggcggccgcg
acgatcgaggaccagcccaatgccaccgtggtcgacaacgaggtggtcgaggtcgcgggc
ctgcgcatcgccggcatcggcgatccccgcttcgcggccgacgacgactccgacgccggc
ggctggcgcgagggcgacgaggcggtggacgccagcgtcttccagctcggggacaccatc
caggcgtacgacgcgacgcaccccgaggagccggtggacatcgccctggtccacgacccg
acccagccggaggggctcctgggccgcaccccgctggtgatgtccgggcacatgcacacc
tcgaaggtcgagctggaccgcgagggatccggcaccgactggctcaccgtcggctcgacc
ggcggggcgctcgcctcgggcggggtgcagccggtcctccggggagaggcgcccctggac
ctcaccgcacggatgctctatttcgacaaggagacccgccggctggtcgcctacgacgac
atcgtcatgggcgggctcggcctggtgtcggtctcgatcgcccgcacgcagatgcccgag
gaggcgccggtgctcgagatccctgacagcgccgagacgccggagggcaccatcccgccg
gagcaggaggtcgccccgggcgagggcctgccggacgaggaccgcgtcacccccaccgac
cccgtcagcccgccgcccgagaccgacggtcccgccccctcggacagcggcggcggagca
ggcgggggcggaggaagcgacggcggaggcggctga

DBGET integrated database retrieval system