KEGG   Brachybacterium ginsengisoli: CFK41_13145Help
Entry
CFK41_13145       CDS       T05099                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
bgg  Brachybacterium ginsengisoli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo ABC1
Motif
Other DBs
NCBI-ProteinID: ATG55613
UniProt: A0A291GZI0
LinkDB All DBs
Position
complement(2935777..2937825)
Genome map
AA seq 682 aa AA seqDB search
MAVMPTPRTPRRAERDPRLAALAEESGYEILGRIGTGGMGIVYRAQDADGNDVAIKLLRH
EIADDARARERLAREVTAQKLVRNDNIVRILDAELDSSESFVVTEFIPGPTLEDAVRSHG
GLHPEAVREIGLVMGDTLRAIHDAGVIHRDLKPSNVMLRGATEHDLAGFDPDGDRLDPVI
IDFGIAIAAEESRLTSTGLVMGTAAYLDPEVIRTDHTGEAGDWWAWAALLSFAATGREPY
GSGRADLVFLRADRGELDVDGVPTELAAWLRGALHADPAQRTAPAELLEGLAALDLTRYD
DPGDTEMLQTGSSTTALPVAEREESAEDADPETTVLPVEDHQERTAVLPAVDAASSTPSG
PPAPPAPPGRSAGAGSAAPADQPTEALPRIATPSEPVTEALPVMGPPTMALPVVPPQHSP
PQPQQSSPQHLQTQPHQNPYDQQPHAQNLHAQNLHAQQPAPAQWGPGGQVQVAGPAGMQG
VWPEPPPRRPLLVWLGHLLIVALAAVAPYMSLVLLLVLGTMARTWERTHRSVSAKRMRGA
TGSGPSWAAGLASPFRACLALLEIALQALLPLILGLLVGIALDAGWTLLRGTPPPNGVVF
ALAMLITLVITWVGLGSLTTRNGAHRMLDAAAPDRLWGSVVLVLLLLLLGAVITTVLARE
GMVDYFPFPNGPRLDDIAIWRR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcatgcccacgccccgcacgccccgacgcgccgagcgcgatccgcgcctggcc
gcgctcgccgaggaatccggctacgagatcctcggccgcatcggcacgggcgggatgggg
atcgtctaccgggcgcaggacgccgacggcaacgatgtggccatcaagctgctgcgccac
gagatcgccgatgacgcccgcgcccgcgaacggctggcccgcgaggtcacggctcagaag
ctggtgcgcaacgacaacatcgtgcggatcctggatgcggagctcgactcctccgagtcc
ttcgtggtcaccgagttcatccccggccccaccctcgaggacgcggtgcgctcccacggc
ggcctgcatcccgaggcggtgcgcgagatcggcctggtcatgggggacaccctgcgggcc
atccacgacgccggggtgatccaccgcgatctcaagcccagcaacgtcatgctgcgcggc
gccaccgagcacgacctcgccggcttcgaccccgacggcgaccggctggaccccgtgatc
atcgacttcggcatcgcgatcgccgcggaggagtcacggctgacctcgacgggcctcgtg
atgggcaccgccgcctacctcgaccccgaggtgatccgcacggaccacaccggcgaggcg
ggggactggtgggcctgggcggcgctgctgtccttcgccgccaccgggcgggagccctac
ggcagcggccgggccgatctggtgttcctgcgcgcggaccgcggggagctcgacgtggac
ggcgtccccaccgagctcgcggcctggctgcgcggagcgctgcacgccgatcccgcgcag
cgcaccgctcccgccgagctgctcgagggcctcgccgcgctcgacctgacccgttacgac
gaccccggcgacaccgagatgctgcagaccggatcgagcaccaccgccctgcccgtggcg
gagcgcgaggagagcgcggaggacgcggacccggagacgacggtgctgccggtggaggac
caccaggagcgcaccgcggtgctgcccgccgtcgacgcggcctcgtccactccctccggc
ccgcccgccccgcccgccccgcccggccgctccgccggcgccgggtccgccgcccccgcg
gaccagcccaccgaggcgctgccacgtatcgccacgccgtcggagcccgtgaccgaggcg
ctgccggtgatggggccgcccaccatggcgctgcccgtggtgccgccgcagcactccccg
ccgcagccccagcagtcgtccccccagcacctgcagacgcagccgcaccagaacccgtac
gaccagcagccgcatgcccagaacctgcatgcccagaacctgcacgcccagcagcccgcg
cccgcgcagtggggtccgggcgggcaggttcaggtcgccggcccggcggggatgcagggc
gtctggcccgagccgccgccgcgccggccgctgctggtgtggctcgggcacctgctcatc
gtggcactcgccgcggtggccccctacatgtccctggtcctgctgctggtgctgggcacc
atggcccgcacctgggagcggacccaccgcagcgtgagcgccaagcggatgcgcggcgcg
accggctccggcccgagctgggccgcgggcctggccagcccgttccgcgcctgcctcgcc
ctgctggagatcgcgctgcaggcgctgctgccgctgatcctcgggctgctggtgggcatc
gcgctcgatgcggggtggaccctgctgcgcggcacgccgccgccgaacggggtggtcttc
gcgctcgcgatgctcatcacgctcgtgatcacctgggtggggctgggaagcctcaccacc
cgcaacggcgcccatcgcatgctcgacgccgccgcgccggaccgtctgtggggctccgtg
gtgctggtgctgctgctcctgctgctcggtgccgtgatcacgacggtgctggccagggag
gggatggtggactacttccccttcccgaacggtccccggctggacgacatcgcgatctgg
agacggtga

DBGET integrated database retrieval system