KEGG   Brachybacterium ginsengisoli: CFK41_13290Help
Entry
CFK41_13290       CDS       T05099                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00620  Pyruvate metabolism
bgg00680  Methane metabolism
bgg01100  Metabolic pathways
bgg01120  Microbial metabolism in diverse environments
bgg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFK41_13290
  09102 Energy metabolism
   00680 Methane metabolism
    CFK41_13290
Enzymes [BR:bgg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFK41_13290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PrkA
Motif
Other DBs
NCBI-ProteinID: ATG55638
UniProt: A0A291GZI5
LinkDB All DBs
Position
complement(2967256..2970084)
Genome map
AA seq 942 aa AA seqDB search
MPHSDAIAVPTLTSEFPVVGDDPHIDAPLRATVRRLSTLLGRALADQHGQEMLDLVEQVR
KLTKEAKSADSEASAQDVQQRLAALPIEQATALTRAFSQYFLLANAAEQVYRVRALDERP
ADESWMPRTVRAVHEEIGAEGLQKAVDSLDVRLIFTAHPTEASRRAVLTKLRRISDILAE
DTEEGTTERRRQDRDLAELVETLWQTDELRRQRPTPQDEARNALYYLRQIFRQTMPEMLD
DLREELREHGVQMRDDQVPLRFGSWIGGDRDGNPFVTAQVTREVLELQADNAIDLAIEVV
SDLILELSVSSELTGEDEELRASLAQDLEHESELDEEQQEQYRQEPYRLKLGAIRAKLRA
TRDRIRSGEAHLHGRDYASGEELQEDFRVLREALRRHGGERLADGALGVAQQVLAASGLN
LATLDVREHSEKHHEVAARLFDRVGELDRPYAELSREERTSVLGHELGSRRPLVGAAIVE
DESILDDPTRTTYNVFREIRDAHRLYGTSVIETYIISMTHGADDVLAAALLAREAGLISI
AGNEEHRADLGFVPLLEEVSELRHAGEILDELLSDASYREVVRLRGDRQEVMLGYSDGNK
DAGVMTSQWEIHQAQRSLRDAAARHGVTLRLFHGRGGSVGRGGGPTYDAILAQPYGVLEG
EIKFTEQGEVISDKYMLPSLARENLDLSLAAVLEGSALHTTPRSTPEQLDRFGEVMQSVS
DASFARYRTLVDDENLPEYFVSATPVEQLGDLNIGSRPSKRASSSKGLDGLRAIPWVFGW
TQSRQIVPGWFGVGSGLKAAREAGLEPDLHEMYRSWHFFRTVISNVEMTLAKTDMQIAAH
YVHSLVPENLWYLFDRIREEYELSVAEIERLTGVLDLLDNQPILKRTLAVRDRYLDPISY
MQVAMLQRARAATANGEELSPELQRALLTTINGVAAGLKNTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgccacattccgacgccatcgccgtcccgaccttgacgagcgagttccccgtcgtcggc
gacgatccgcacatcgacgcccctctccgggcgaccgttcgccgcctctcgaccctgctg
gggcgtgcactcgccgaccagcacggccaggagatgctcgacctcgtcgagcaggtccgc
aagctgaccaaggaggcgaagtccgccgattccgaggccagcgcccaggacgtccagcag
cgcctcgctgccttgcccatcgagcaggccaccgccctgacccgtgcgttctcccagtac
ttcctgctggccaacgccgccgagcaggtctaccgggtgcgcgccctcgacgagcgcccg
gccgacgagtcctggatgccccgcaccgtgcgggccgtccatgaggagatcggggcagag
ggcctgcagaaggccgtcgactccctcgacgtgcgcctgatcttcaccgcgcatcccacc
gaggcctcgcgccgtgcggtgctcaccaagctgcgccgcatctcggacatcctcgccgag
gacacggaggagggcaccaccgagcgccgccgtcaggaccgcgacctcgccgagctcgtc
gagacgctctggcagaccgacgagctgcgccgccagcgccccaccccgcaggacgaggcc
cgcaacgccctctactacctgcgtcagatcttccgccagaccatgccggagatgctcgac
gacctccgcgaggagctgcgcgagcacggtgtgcagatgcgcgacgaccaggtgccgctg
cgcttcggctcctggatcggcggcgaccgtgacggcaatcccttcgtcaccgcccaggtc
acccgcgaggtgctcgagctccaggccgacaacgcgatcgacctcgccatcgaggtggtc
tccgacctgatcctcgagctgtccgtctccagcgagctgaccggtgaggacgaggagctg
cgggcgagcctcgcccaggacctcgagcacgagtccgagctcgacgaggagcagcaggag
cagtaccgccaggagccctaccgcctcaagctcggggcgatccgggccaagctgcgcgcc
acccgcgatcggatccgctccggcgaggcgcacctgcacggcagggactacgcctccggc
gaggagctgcaggaggacttccgggtcctgcgcgaggcgctgcgccgtcacggcggggag
cggctcgccgacggcgccctgggcgtggcccagcaggtgctggccgcctccgggctgaac
ctcgccaccctcgacgtgcgcgagcactccgagaagcaccatgaggtcgcggcccgtctg
ttcgaccgggtgggcgagctggaccgcccctatgcggagctcagccgcgaggagcgcacc
tcggtgctcgggcacgagctcggcagccgtcggccgctggtcggtgcggcgatcgtcgag
gacgagtcgatcctcgacgaccccacccgcaccacctacaacgtgttccgcgagatccgc
gacgcccaccgtctgtacggcacctccgtcatcgagacctacatcatctcgatgacccac
ggcgccgacgacgtgctcgccgcagcgctcctggcccgtgaggcggggctgatcagcatc
gccggcaacgaggagcatcgggcggatctcggcttcgtgccgctgctcgaggaggtctcc
gagctgcgccatgccggcgagatcctcgacgagctgctcagcgacgcctcctaccgcgag
gtcgtgcgtctgcgcggcgatcgccaggaggtcatgctcggctactccgatggcaacaag
gacgccggggtgatgacgagccagtgggagatccatcaggcccagcgctcgctgcgcgat
gcggcggcccggcacggcgtcaccctgcggctgttccacggccgcggaggctccgtcggc
cgaggcggcggccccacgtacgacgcgatcctggcccagccgtacggcgtgctcgagggc
gagatcaagttcaccgagcagggcgaggtcatctccgacaagtacatgctgccctcgctg
gcccgggagaacctggacctgtcgctggccgccgtgctcgagggctccgcgctgcacacc
acgccgcgctcgacccccgagcagctggaccgattcggcgaggtcatgcagtcggtctcg
gatgcgtccttcgcgcgataccgcacgctggtggacgacgagaacctgccggagtacttc
gtctcggccaccccggtcgagcagctcggcgacctgaacatcggctcgcgcccctccaag
cgcgccagctcctcgaaggggctggacggtctgcgggccattccgtgggtgttcggctgg
acccagtcgcggcagatcgtgccgggctggttcggtgtgggctccggcctgaaggccgcc
cgggaggccggcctcgagccggacctgcacgagatgtaccgcagctggcacttcttccgc
accgtgatcagcaatgtcgagatgacgctcgcgaagacggacatgcagatcgccgcgcac
tacgtgcactcgctggtgccggagaacctctggtacctcttcgatcggatccgcgaggag
tacgagctctccgtggccgagatcgagcggctcaccggcgtgctggacctgctggacaac
cagccgatcctcaagcgcaccctcgccgtgcgcgatcgctacctggacccgatctcctac
atgcaggtcgcgatgctgcagcgggcccgtgccgcgaccgcgaacggcgaggagctctcg
ccggagctccagcgcgcgctgctgaccaccatcaacggtgtcgcagcgggtctgaagaac
accggctga

DBGET integrated database retrieval system