KEGG   Brachybacterium ginsengisoli: CFK41_15600Help
Entry
CFK41_15600       CDS       T05099                                 

Definition
(GenBank) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00260  Glycine, serine and threonine metabolism
bgg00270  Cysteine and methionine metabolism
bgg00450  Selenocompound metabolism
bgg01100  Metabolic pathways
bgg01110  Biosynthesis of secondary metabolites
bgg01130  Biosynthesis of antibiotics
bgg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFK41_15600
   00270 Cysteine and methionine metabolism
    CFK41_15600
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFK41_15600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgg04147]
    CFK41_15600
Enzymes [BR:bgg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     CFK41_15600
Exosome [BR:bgg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFK41_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP GDC-P Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATG56044
UniProt: A0A291H106
LinkDB All DBs
Position
3468449..3469558
Genome map
AA seq 369 aa AA seqDB search
MDSDPALLADMLHHRTGSLPAGSPVALPLTPASTYALPGTIDAPFTYGRAGGPTWSALEE
ALGVLEQAETVVLPSGMAAISAVLLTHLTRGDRVLLPSDGYYATRRLAEQFLTPVGVEVV
LRPTAEYAQQDLDGFTVVLVETPSNPALDLCDIAEVSARAHAAGALVVVDNTTLTPLGQR
PLELGADVVVASDTKAPNGHSDALLGHVATRRPDVLERVRQWRTLAGGIPGQLETWLVHR
GLETLELRFDRMCSSALVLAERLEEHPATRDVVHPGLPSHPQHELASRQMARAGSLIGFA
LPDAETAERFLERARRVVSATSFGGVHTSAERRARWGDAVPEGFVRLSVGCEPTEELWAD
LEQALRGLG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggactccgaccccgcgctgctcgccgacatgctccaccaccgcacggggtcgctgccc
gccggctccccggtcgccctgccgctgacgcccgcgagcacctatgccctgcccggcacc
atcgacgcccccttcacctacggccgcgcgggcggtcccacctggtcggcgctcgaggag
gcgctcggcgtgctcgagcaggcggagacggtggtcctcccctcgggcatggcggcgatc
tcggcggtgctgctcacccatctgacccggggcgaccgggtgctgctgccgtcggacggc
tactacgcgacccgtcgtctggccgagcagttcctgaccccggtcggggtcgaggtggtg
ctgcgccccacggcggagtacgcgcagcaggacctggacgggttcaccgtggtgctcgtg
gagaccccatcgaacccggccctggacctctgcgacatcgccgaggtctcggcgcgggcc
cacgccgccggcgcgctggtggtcgtggacaacacgaccctcaccccgctcggtcagcgg
ccgctggagctgggggccgacgtggtcgtcgcctcggacaccaaggccccgaacggccac
tccgacgcgctgctcggccatgtcgcgacccgtcggccggatgtcctggagcgggtgcgg
caatggcgcaccctcgccggcgggatcccggggcagctggagacctggctggtccaccgc
ggcctggagaccctcgagctgcgcttcgaccggatgtgctcgagcgccctggtcctcgcc
gagcgcctcgaggagcatccggccacccgggacgtggtccatcccggtctcccgagccat
ccgcagcacgagctcgcctctcggcagatggcgcgggccggctccctcatcggcttcgcc
ctgcccgacgcggagaccgccgagcgcttcctcgagcgtgctcgccgggtggtgtcggcg
accagcttcggcggcgtgcacaccagcgccgagcggcgcgcccgctggggcgatgcggtc
ccggaggggttcgtgcgcctctccgtgggctgcgagccgaccgaggagctgtgggcggat
ctcgagcaggcgctgcgcgggctcggctga

DBGET integrated database retrieval system