KEGG   Brachybacterium ginsengisoli: CFK41_16505Help
Entry
CFK41_16505       CDS       T05099                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bgg  Brachybacterium ginsengisoli
Pathway
bgg00052  Galactose metabolism
bgg00511  Other glycan degradation
bgg00600  Sphingolipid metabolism
bgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CFK41_16505
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CFK41_16505
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CFK41_16505
Enzymes [BR:bgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CFK41_16505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: ATG56201
UniProt: A0A291H160
LinkDB All DBs
Position
complement(3695091..3697802)
Genome map
AA seq 903 aa AA seqDB search
MTPPPRSRQRLESGWRFQRIAPDQVDHALDYIPWPELGAAEDGKDADARPEQVRHDAADT
GLRPWILPTASPFVHDPSARAERPEGAPPVRPRAADPGTDDADWQQVTVPHDWAIAGPFL
VEGPHGGMGRLESWGVGWYRRDLEILAEDTGRSIHLEIDGAMSYASVWLNGTLVGGWPYG
YTSWRLDLTPHVRPGERNLLAIRLDNPPRSARWYPGGGLFRDVHLVRTAPVAVGHWGTTI
TTHEVSEDSADVDVEVRLVNAGSQPVAVQVETEIHTIPDGSGMPGTGSPAGTLVATTGPG
TADVGPGAEATLSGSASIQRPALWGPPPTQRPHRHLAVTTVRQGGEVVDQVRTPFGVRRI
EFDADEGLLVNGERIRIQGVNNHHDLGSLGAAFHERAAERQLEILQEMGANALRTAHNPP
APELLDLTDRMGILVLDEVFDSWYARKTDLDFHLIFEDWHEADLRAMIRRDRHHPSVILW
GIGNEVGEQYTEEEGALVARRLVEIAHQEDPSRLTTTAMNYAKPHMPLPAEVDVIGINYQ
GEGIRQEPIFEGTDRIRTPPQYPLFREAFPRTPMLGTETASALSTRGTYLFPVAEEQSGP
ARDGRGADDASCTVSAYELHAVDFGSTAEKVFASLESHPYVAGEFVWTGFDYLGEPTPYY
SARSSYTGIVDLAGFPKDRFWLYRSQWRPEVPTAHLLPHWTWPGREGEVTPVHVFTSGDE
AELFVDGVSQGRRRKQPGQFRLRWDETVYTPGEVRVQVYRDGAPWAEDVVRTAGAPAHLE
LTADRSAITADGRDLVHVSARVLDADGVEVPTATDLLRFAVEGPGRILATDNGDPTDMTA
FPSPERRAFSGRALAVVAAERGADGTLRVSASAEGLQGDEVLVQLARSPRPGGRTAGTGA
GER
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccccgccccgcagcagacagcgcctcgagagcgggtggcgcttccagcggatc
gcccccgaccaggtggatcacgccctggactacatcccctggccggagctcggcgccgcc
gaggacggcaaggacgccgacgcccgccccgagcaggtgcgccacgacgcggcggacacc
ggtctgcggccgtggatcctgcccaccgcgtcccccttcgtccatgacccgtcggcccgc
gccgagcggccggagggtgcaccgcccgtccggccccgagctgccgaccccggcaccgac
gacgccgactggcagcaggtcaccgtgccccatgactgggcgatcgccggccccttcctg
gtggagggcccgcacggcggcatggggcgcctggagagctggggagtgggctggtaccgc
cgtgacctggagatcctcgccgaggacacgggccgatcgatccacctggagatcgacggg
gcgatgtcctacgcctcggtgtggctcaacggcaccctggtgggcggctggccctacggc
tacaccagctggcgcctggacctcacgccccacgtgcggccgggcgagcggaacctgctg
gcgatccggctggacaacccgccgcgctcggcccgctggtaccccggcggagggctcttc
cgcgacgtccacctggtgcgcaccgccccggtcgccgtcggccactggggcacgacgatc
accacccacgaggtcagcgaggactccgccgacgtcgacgtcgaggtgaggctcgtgaac
gccggctcgcagccggtcgccgtgcaggtcgagaccgagatccacacgatccccgacggg
agcggcatgcccggcaccggatcgccggcgggcaccctcgtcgcgaccacgggaccgggc
accgccgacgtcggccccggcgccgaggccaccctctccggatcggccagcatccagcgg
cctgcgctgtggggaccgccgcccacccagcggccccaccgccacctcgccgtcaccacg
gtgcggcagggcggcgaggtggtggaccaggtccgcacccccttcggcgtgcgccggatc
gagttcgacgccgacgagggactgctcgtcaacggcgagcggatccggatccagggcgtg
aacaaccaccacgacctcgggtccctgggtgcggccttccacgagcgcgcggccgagcgg
cagctcgagatcctgcaggagatgggcgcgaacgcgctgcgcacggcgcacaacccgccc
gctcccgagctgctggacctcaccgaccggatggggatcctggtgctcgacgaggtgttc
gactcctggtacgcccgcaagaccgacctcgacttccatctgatcttcgaggactggcac
gaggcggacctgcgggcgatgatccgccgcgaccgccaccacccctcggtgatcctgtgg
gggatcggcaacgaggtcggcgagcagtacacggaggaggagggcgcgctggtcgcccgg
cgcctggtggagatcgcgcatcaggaggacccgagccgcctgaccacgaccgcgatgaac
tacgccaagccgcacatgccgctgccggccgaggtggacgtcatcggcatcaactaccag
ggcgaggggatccggcaggagccgatcttcgagggcaccgaccggatccgcaccccaccc
cagtacccgctcttccgggaggcgttcccccgcacgccgatgctcggcactgagaccgcc
tcggcgctgtccacccgcggcacctacctcttccccgtggcggaggagcagagcggcccg
gcccgggacggccgcggagccgacgacgcgagctgcaccgtcagcgcctacgagctccac
gccgtggacttcgggtccacggcggagaaggtcttcgcctccctcgagagccacccctac
gtggccggggagttcgtctggaccggcttcgactacctgggcgagcccaccccgtactac
tcggcccgcagctcgtacaccggcatcgtggacctcgccggcttccccaaggatcgtttc
tggctgtaccgctcgcagtggcggccggaggtgcccaccgcgcacctgctgccgcactgg
acctggccgggccgggagggcgaggtgacgcccgtgcacgtgttcacctcgggcgacgag
gccgagctgttcgtggacggcgtctcccagggccgccgccggaagcagcccgggcagttc
cgcctgcgctgggacgagaccgtctacacgccgggcgaggtgcgggtgcaggtctatcgg
gacggtgcgccgtgggccgaggacgtggtccgcaccgccggtgcccccgcccacctcgag
ctcaccgccgaccgcagcgcgatcacggccgacgggcgcgacctcgtccacgtctccgcc
cgtgtgctcgacgccgacggggtcgaggtgcccactgccaccgacctgctgcgcttcgcc
gtcgagggcccgggccggatcctcgccaccgacaacggcgaccccaccgacatgaccgcg
ttcccctcgccggagcgtcgggcgttcagcggcagggcgctcgccgtcgtcgccgccgag
cgcggggccgacggcacgctccgcgtgagcgcgagcgccgagggcctgcagggcgacgag
gtgctcgtccagctcgcacggagcccccgccccggcggcaggaccgcggggacgggggct
ggggagcgctga

DBGET integrated database retrieval system