KEGG   Bacillus gibsonii: BGM20_00480Help
Entry
BGM20_00480       CDS       T04820                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bgi  Bacillus gibsonii
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BGM20_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AOL29179
LinkDB All DBs
Position
complement(79236..80000)
Genome map
AA seq 254 aa AA seqDB search
MSVSIILMGLFVGALVGLTGVGGAALLTPLLIVLGINPSIAVGTDLVYNSITKLFGVASH
WRQKTINFKLVKYLAIGSIPSASLAIGILHLFPAFHQHQEEIIKHALGYVLTLVAISIIV
RLFLDRKLRPNRWQLMPLENKRALTILIGVVFGFIVGLTSIGSGSLFAIAMIYLFNMKAS
QIVGTDIAHAFLLVTAAGILNASFGSVDYMLAANLLLGSIPGVLIGSHLSPRFSPRPLQF
IMASIILVSGLKLI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaagcatcatattgatgggtttgtttgtcggagccttagtcggattgacggga
gtgggtggagcggccttattaactccccttttaattgtgcttggaattaatccttccatc
gcggtcggtacggatcttgtatataactcgatcacaaagctgtttggcgttgcctcccat
tggcggcagaaaacgattaactttaaattggtaaaatacttagccatcggcagtattccg
agtgcttcgctagccattggcatattgcatttgttccccgcctttcaccagcatcaggaa
gaaattattaagcacgctctaggatatgtgttaacgctggttgccatttcaatcatcgtt
cgtttgtttttggatagaaaacttcgccccaaccgctggcagctgatgccgcttgaaaat
aagagggcgctgacaattcttattggtgttgtgtttgggtttatcgtcggattaacatca
atcgggtccggctcattatttgcaatcgccatgatttacttatttaacatgaaagcgtca
cagattgtcggaaccgatatcgcgcatgcttttcttcttgttacggcagcaggcattttg
aacgcaagcttcggaagcgtggattacatgctggcagctaatctgctcctcggttcaatt
cccggcgtactgatcgggagccatctttcgcctcgattctccccgcgtccactgcaattt
attatggcttccattattttagtcagcggtttaaaattgatttaa

DBGET integrated database retrieval system