KEGG   Bacillus gibsonii: BGM20_02360Help
Entry
BGM20_02360       CDS       T04820                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
bgi  Bacillus gibsonii
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bgi03036]
    BGM20_02360
Chromosome and associated proteins [BR:bgi03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BGM20_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_21 AAA_15 AAA_29 DUF2647 UPF0242 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AOL29538
LinkDB All DBs
Position
430923..434483
Genome map
AA seq 1186 aa AA seqDB search
MFLKRLDVIGFKSFAERISVDFVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARSLRGGK
MEDIIFAGSDSRKRLNLAEVTLTLDNDDHFLPIDFHEVSVTRRVYRSGESEFLINNQPCR
LKDIIDLFMDSGLGKEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENK
LFETQDNLNRVEDILHELEGQVEPLKIQASIAKDYLEKKKELEHVEIALTAYDIEELHGK
WSTLKEKVQMAKEEELAESSAISAKEAKIEDTRDKIQALDESVDELQQVLLVTSEELEKL
EGRKEVLKERKKNAVQNQEQLEEAIVQFQQKETVLKEELSKQEAVFETLQAEVKQLRAQV
KEKQQALSLHNENVEEKIEQLKSDYFELLNSQASIRNELQLLDDQMSQSAVTLQRLADNN
EKHLQERRDISARKAACETEFARIEQEIHSQVGAYRDMQTKYEQKKRQYEKNESALYQAY
QYVQQARSKKDMLETMQGDFSGFYQGVKEVLKAKERLGGIRGAVLELISTEQKYETAIEI
ALGASAQHVVTDDEQSARKAIQYLKQNSFGRATFLPLSVIRDRQLQSRDAETAARHSSFL
GVASELVTFDPAYRSVIQNLLGTVLITEDLKSANELAKLLGHRYRIVTLEGDVVNPGGSM
TGGAVKKKNNSLLGRSRELEDVTKRLAEMEEKTALLEQEVKTLKHSIQDMEKKLADLRET
GEGLRLKQQDVKGQLYELQVAEKNINTHLELYDQEKSALSESDEERKVRKRKLEEELSAV
SEKMKQLEEDIDKLTKQKQTQSSTKESLSNELTELKIAAAKKEQACKGEEDNLARLKKEL
TETELALKEAKEDLSFLTSEMSSSTSGEEKLEEAAKHKLNDKTKTIELIALRRDQRIKLQ
HGLDTYERELKEMKRLYKQKTTLLKDEEVKLGRMEVELDNLLQYLREEYSLSFEGAKEKY
QLETDPEEARKRVKLIKLAIEELGTVNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQ
VIEEMDEEMTKRFNDTFVQIRSHFDQVFRSLFGGGRAELRLTDPNDLLHSGVEIIAQPPG
KKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSS
DTQFIVITHRKGTMEEADVLYGVTMQESGVSKVISVKLEETKEFVQ
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcaaacgtttagacgttataggatttaaatcatttgcagaacggatttccgta
gacttcgttaaaggcgtgacagcagttgtcgggccgaacggaagcggaaaaagcaacatc
acggatgccattcgctgggttctcggcgaacaatcggcacgctctcttcgcggcggaaaa
atggaagacatcatttttgccgggagtgattcaagaaagcgattaaatctagctgaagtt
acgcttactcttgataatgatgatcatttcttgccaattgacttccacgaggtgagtgtc
acaagacgtgtgtacagatcaggtgagagtgagtttctgattaacaatcagccatgccgc
ttgaaagatattattgatttatttatggactctgggcttggtaaagaagcattttctatt
atcagccaagggaaagtggaagagatcctgagcagtaaagcggaggatcgccgcagtatc
tttgaagaagcggccggggtgcttaaatataaaacgagaaagaaaaaagcagaaaataaa
ctgtttgagacacaggacaatctaaatcgggtagaagatatattacatgagcttgaaggg
caggttgaacctcttaaaattcaagcttcaatagcgaaagactaccttgagaaaaagaaa
gagctggagcatgttgaaattgcgctgactgcctatgatatcgaagagctgcatggtaaa
tggtcgactcttaaagagaaagtgcagatggcaaaagaagaagagcttgctgaatcgtct
gctatttctgcgaaagaagcaaagattgaggatacaagggacaaaatacaagcgcttgat
gagtcagtagatgagctccagcaagttttactggtaactagtgaagagctggaaaagctt
gaaggccgtaaagaagtcctgaaagaacgaaagaaaaacgctgtgcaaaaccaagaacag
cttgaagaagccatcgttcagttccagcaaaaagaaacggttctgaaagaagagctttcg
aagcaggaagctgtcttcgaaacgcttcaggctgaggtgaagcagttaagggcgcaagta
aaagaaaaacagcaggctctcagtcttcacaatgaaaatgtcgaagagaaaatcgagcag
ctgaaaagtgattattttgagctgttaaacagccaggcttcgatacgcaacgaactccag
cttcttgatgaccagatgtcccaatccgctgtcacattgcagagactcgcggacaacaat
gaaaagcacctgcaggaacggcgtgatatttctgcgcgtaaagccgcatgtgaaacggaa
tttgcccgaattgagcaggagattcacagtcaagtcggtgcatatcgtgatatgcagaca
aaatatgagcagaaaaagcgccaatacgaaaaaaatgaatccgctctgtatcaggcatac
caatacgttcagcaagcgagatcaaaaaaggacatgcttgagacgatgcagggagatttc
tccggcttttatcaaggtgttaaagaagtgctaaaagcgaaagagcgccttggtggaatt
cgcggagcggttcttgagctgatttctacagaacaaaagtatgaaacggccattgaaata
gcgctcggcgcttctgctcagcatgtcgtgaccgacgatgaacaatctgcccgaaaagcg
attcaatatttaaagcagaattccttcggccgggcgacgtttctgcctctttctgttatt
agagaccgccagcttcaaagccgtgacgcggaaacagccgcccggcattcatcatttctc
ggggttgccagtgaacttgtcacatttgatcctgcgtatcgaagcgtcatccagaatctt
cttggaaccgttctgatcacagaggacttaaagagcgcaaacgagcttgcgaagcttctc
gggcaccggtaccgcatcgtaacccttgagggagatgttgtgaaccccggtggttcaatg
acgggcggcgcggttaaaaagaaaaataactccctcctcggaagaagccgggagctagaa
gatgtgacgaaacggctcgctgaaatggaagagaaaacagctctgcttgaacaagaggtc
aaaacccttaagcactccattcaggatatggagaaaaaactggctgacttaagagaaacc
ggggaaggcttaaggttaaagcagcaggatgtgaaaggccagctgtacgaacttcaagtt
gccgagaaaaatatcaatacccatttagagctctatgaccaagaaaaatctgctctgtca
gaaagcgatgaagagagaaaagtgcgcaaacgcaagcttgaagaagagctctctgccgta
tctgaaaagatgaaacagcttgaagaggacatagacaaactgacaaaacaaaaacaaacg
caatcctcaacgaaagagtctctctccaacgagctgactgagctgaagatcgctgcggcc
aaaaaagagcaggcatgcaagggggaagaggacaaccttgccagattaaagaaagagctc
actgaaacagagcttgcgttaaaagaagcaaaagaagacttaagcttcttaacgtcagag
atgtcatctagcaccagcggcgaagaaaagctggaagaagcagcaaaacataaattgaat
gacaaaacgaaaacgatcgaactgattgcattaaggcgcgatcagcgcatcaagcttcag
catgggcttgatacgtatgagcgtgagctgaaagaaatgaaacgcctgtataaacaaaaa
acaacgctcttaaaagacgaagaagtcaaacttggacgaatggaagtcgagcttgataat
ttactccaatacttacgggaggaatacagcttgtcctttgagggggcaaaagagaaatat
cagcttgaaactgatccagaggaagccagaaagcgcgtgaagctgattaaactcgcaatt
gaagagctgggtaccgtgaatctcggaagcatagatgagtttgagagggtcaacgaacgg
tacaagtttctgtcggaacaaaaagaagatttaacagaagcgaaaaataccttgtttcaa
gtgattgaagaaatggatgaagaaatgacgaagcgctttaacgacacattcgtccaaatc
cgctcacactttgatcaagttttccgctccttattcggaggagggcgagctgaactgagg
ctcaccgatcctaacgatctgcttcattcaggagtcgagattatcgctcagccgccgggg
aaaaagctgcaaaacttaaatctcctgtcaggcggagagcgtgcgcttactgctatagcg
ctcttattctcaatcctaaaggttcgtccagtgccgttttgcgtccttgacgaagttgag
gctgcgctcgacgaagcgaatgtgttccgatttgcgcagtatttaaaaaaatacagcagt
gatacccagtttattgtgattacccacagaaaaggaacgatggaggaagcggatgtgctt
tatggcgtaaccatgcaggaatccggtgtttccaaggtaatctccgttaagctggaagaa
acaaaagaattcgttcagtaa

DBGET integrated database retrieval system