KEGG   Bacillus gibsonii: BGM20_07425
Entry
BGM20_07425       CDS       T04820                                 

Definition
(GenBank) PTS fructose transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bgi  Bacillus gibsonii
Pathway
bgi00051  Fructose and mannose metabolism
bgi02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGM20_07425
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BGM20_07425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgi02000]
    BGM20_07425
Enzymes [BR:bgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BGM20_07425
Transporters [BR:bgi02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BGM20_07425
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AOL30469
LinkDB
Position
complement(1419292..1419732)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccattttttaaaggggaagga
atacaaacactgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggcagccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system